KEGG   Neoasaia chiangmaiensis: A0U93_02015Help
Entry
A0U93_02015       CDS       T04705                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00010  Glycolysis / Gluconeogenesis
nch00053  Ascorbate and aldarate metabolism
nch00071  Fatty acid degradation
nch00280  Valine, leucine and isoleucine degradation
nch00310  Lysine degradation
nch00330  Arginine and proline metabolism
nch00340  Histidine metabolism
nch00380  Tryptophan metabolism
nch00410  beta-Alanine metabolism
nch00561  Glycerolipid metabolism
nch00620  Pyruvate metabolism
nch00625  Chloroalkane and chloroalkene degradation
nch01100  Metabolic pathways
nch01110  Biosynthesis of secondary metabolites
nch01120  Microbial metabolism in diverse environments
nch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0U93_02015
   00053 Ascorbate and aldarate metabolism
    A0U93_02015
   00620 Pyruvate metabolism
    A0U93_02015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0U93_02015
   00561 Glycerolipid metabolism
    A0U93_02015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0U93_02015
   00310 Lysine degradation
    A0U93_02015
   00330 Arginine and proline metabolism
    A0U93_02015
   00340 Histidine metabolism
    A0U93_02015
   00380 Tryptophan metabolism
    A0U93_02015
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A0U93_02015
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A0U93_02015
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A0U93_02015
Enzymes [BR:nch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A0U93_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQS86921
UniProt: A0A1U9KMA4
Position
complement(423988..425514)
Genome map
AA seq 508 aa AA seqDB search
MEMDMVELREQTAGLLNDIGVATASIKGGTLAVRSPVNGETLAYVPEISVEDARQAIDIA
HDAALEWRKVPAPVRGELVRLLGEELRADKEKLGRLVSIEVGKSPSEGLGEVQEMIDICD
FAVGLSRQLHGLTIATERPEHRMMETWHPLGAIGIISAFNFPVAVWSWNAALALICGNAI
IWKPSEKTPLTALATHAIFERALKRFAQAPQGLSRLLIGGRDVGEALVDHPKVPLVSATG
STAMGRIVGQKLAGRFARAILELGGNNAAIVTPSADLDLALRGVAFAAMGTAGQRCTTLR
RLFVHRSIHAAFVARLKAAYESVSVGNPLDGHLVGPLIDEASFERMQSALNAAREAGGIV
HGGTRVTVDGCEGGIYVRPALVEMPGQAGPVLEETFAPILYVMVYDALDDAIALQNDVSQ
GLSSAIFSNDLREAERFVSHEGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAW
KGYMRRATNTINYGRSLPLAQGVSFDVG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagatggacatggttgaacttcgggaacaaacggcaggattgctcaacgatatcggt
gtggctacagcctcgatcaagggtggcacgctggctgtccgttcgccggtcaatggtgaa
acgctggcgtatgttccggagatttcagtcgaggatgcccgccaggcaatcgatatcgcc
cacgacgcagcgctggaatggcggaaggtgcctgcccccgtgcgtggcgaactggtgcgc
ctgctgggcgaagagcttcgggccgacaaggaaaagctcggtcgtcttgtttcgatcgag
gtcggcaagtcgccttccgagggactgggcgaggtgcaggagatgatcgacatctgcgat
ttcgcggtcggattgtcccgccagcttcatggtctgaccattgcaaccgaacgtccggaa
catcggatgatggagacatggcacccgctcggcgccatcggcattatctctgcgttcaat
ttccctgttgcggtctggagctggaatgcggcgctcgcgctgatctgcggcaacgccatc
atctggaaaccgtcggagaaaacccccctcaccgcgctggcgacacatgcgatcttcgag
cgtgcgctcaagcgattcgcgcaggcaccgcaaggcctttcccggttgctgatcggtggc
cgcgatgtgggcgaggcactggtcgaccatccgaaagtgccgctggtctccgcgacagga
tcgacggcgatggggcggatcgtcgggcagaagctggcaggtcggttcgcacgtgcgatc
ctcgaactcggcggcaacaacgcggccatcgtgacaccatcggccgacctcgatctggcg
ctgcgtggcgttgcgttcgcggccatgggcacggccggacaacgctgcacgacgctgcgc
cgtcttttcgtgcatcgttccattcatgcggcttttgtcgcgcgcctcaaggcggcttat
gaatcggtcagcgtcggtaatccgttggacggccatctggtcggcccgctgatcgacgag
gcatcgttcgagcggatgcagtctgccctgaatgcggcacgggaggccggcggcatcgtt
catggcggcacgcgcgtaacggtggacgggtgtgaaggcggtatctatgttcgccccgcg
cttgtcgagatgcctggccaggccggacctgttctggaagagacattcgcgcccattctc
tacgtgatggtctatgacgcgctggatgatgccatcgcgcttcagaacgatgtatcgcag
gggctctcgtcggccatcttctccaacgatctgcgcgaagccgagcgtttcgtatcgcat
gaaggttcggattgcggcatcgccaatgtcaatatcggcacctccggagcagaaatcggt
ggcgcattcggcggcgagaaggagaccggtggtggccgtgaatccggctcggatgcctgg
aaaggctacatgcggcgtgcgaccaacacgatcaactacggccgcagcctgccgttggcg
cagggggtcagcttcgacgtcggctga

DBGET integrated database retrieval system