KEGG   Neoasaia chiangmaiensis: A0U93_02340Help
Entry
A0U93_02340       CDS       T04705                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00230  Purine metabolism
nch01100  Metabolic pathways
nch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nch00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A0U93_02340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nch01002]
    A0U93_02340
Enzymes [BR:nch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     A0U93_02340
Peptidases and inhibitors [BR:nch01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   A0U93_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AQS86973
UniProt: A0A1U9KMG3
Position
492313..493887
Genome map
AA seq 524 aa AA seqDB search
MLHSARAKHGMVTAPHHLAAQTGRDILKSGGSAIDAAIGVAATLAVVYPHMTGIGGDGFW
LIRRPDGQVTAIDACGRAARAAEVELYRGRDAIPWHGGLAANTVAGTVSGWQAAHHIGGR
QPIARLLDDAIHYAEDGVIATESLAGLAARHAGDLRHIPGFATLFLPDGAPIATGEVLRN
TALANTLRRLAAAGLSDFYTGSLAADIARDLHTAGSPVDVNDLEAHTATVGTPLSVQLGC
GRFYNTRPPTQGAASLLILALAERWGVRGADTTEDLHKWVEATKRAFLYRDATIADPAIM
MSDPQDLLQDPSALDTMAAAFDPDRATPWPRPSHGGDTTWFGVVDAQGWAVSAIQSLYFE
FGSGVTLPNTGIVWQNRGASFDLSNHGLRRLAPGRKPFHTLNPALAELRDGSIMTYGTMG
GEGQPQTQAAIVARAVIAGMSLQHAITAPRWLLGRTWGEATTTLKLEDRFPGDIVDALRT
MGHDVEILPAFADAMGHAGAIRRYGDGTLEGACDPRSDGTVAAW
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatagcgcgcgcgcgaagcatggcatggtcacagcgccccatcatctcgccgcg
cagaccggccgcgacattttgaaatccggcggttcggccatcgatgccgccatcggcgtg
gccgccaccttggctgtcgtctacccccatatgaccggaatcggcggggacggtttctgg
ctcattcgtcgaccggacgggcaggtaacggcaatcgacgcgtgtgggcgggcggcacgg
gccgccgaagttgaactgtatcgcggcagggatgccataccctggcacggcgggctggcg
gccaatacggtggccggaaccgtctcgggctggcaggccgcacatcatatcggcgggcga
cagccgatcgcgcggcttctcgacgatgcgatccattatgccgaggacggtgtcatcgca
acggaaagcctcgccgggcttgcagcgcgccatgccggtgatcttcggcatattcccggg
ttcgcaacgcttttcctgcctgacggtgcgccgattgcgacgggcgaagttctccgcaat
accgcattggcgaatacactgaggcggcttgcggcggccgggttatccgatttctacacg
gggtcgcttgccgccgatatcgcgcgcgatcttcacaccgccggctctccggtcgatgtc
aacgatcttgaggcgcatacggcgacggtcggcacgccattatccgtgcaactcggatgt
ggccggttttacaatacccgaccgccaacgcaaggcgcagcatccctgctgattctggca
ctggccgaacggtggggcgtgcgtggcgccgatacgaccgaagacctgcataaatgggtc
gaggcgaccaaacgcgcttttctctatcgggacgcgacgattgctgatccggcaatcatg
atgtccgacccgcaggacctgcttcaggatccgtcggcgctggataccatggcggcggca
ttcgatcctgatcgggcgacgccctggccccgcccgtcccatggtggcgacacgacatgg
ttcggtgtcgtcgatgcccagggctgggcggtcagcgcgatacaaagcctgtatttcgaa
ttcggctcgggcgtcacgctgccgaacactggcatcgtctggcagaatcgcggcgcgagt
ttcgacctgagcaaccacggtcttcgtcgtctcgcaccgggccgcaagccgtttcatacc
ctgaatcccgctctggccgaattgcgtgacggcagcatcatgacctacggcacgatgggc
ggggagggacaaccgcaaacccaggcggcaatcgtcgcgcgtgcggtgattgccggcatg
agcctgcaacacgccatcacggcgccgagatggttattggggcgcacatggggcgaagcc
accacgacgttgaaactggaggaccgcttccccggcgatatcgtcgatgcactccgaacg
atggggcacgatgtcgagattcttccggcctttgcggatgccatggggcatgccggtgca
atccggcgttatggcgacggcacgctggaaggcgcatgcgatccgcgtagcgatggcacg
gtggcggcgtggtga

DBGET integrated database retrieval system