KEGG   Neoasaia chiangmaiensis: A0U93_04000Help
Entry
A0U93_04000       CDS       T04705                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00030  Pentose phosphate pathway
nch01100  Metabolic pathways
nch01120  Microbial metabolism in diverse environments
nch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A0U93_04000
Enzymes [BR:nch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A0U93_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase Shikimate_DH Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AQS87243
UniProt: A0A1U9KN73
Position
855411..856211
Genome map
AA seq 266 aa AA seqDB search
MPAPQRDRFRGKNVLITGASQGIGEAAALRFAEEGARVAVNGRHEDKLRAVVDKLPKVDA
GPHVVATGDMSKEDDVDRVMRTSLDEMGGLDVLICNAGIMRPSPSEDITLDDLNAVLAVN
LTSVILCSRAVLKYWRSNDLKGSILVNSSVHQEIPKPQYLGYSASKGAVGNVVRTLALEY
AAHGIRVNGVGPGAIVTPMNDAWVHDPEQYKTVSSHIPMGRPGEGREIADALTFLASEEA
SYITGQMLYVDGGLTLYADFQKNWSS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctccccagcgagaccgcttcagaggtaagaacgtgctgatcaccggcgcttcc
caaggtatcggggaagccgccgccctgcgcttcgcggaagaaggcgcgcgcgttgccgtc
aacggtcgtcacgaagacaagctgcgcgccgtcgtcgacaaactgccgaaggtcgatgca
gggccgcatgtcgtagcaacgggtgacatgtcgaaggaagacgatgtcgaccgtgtcatg
cgcacaagcctggatgagatgggcggacttgatgtcctgatctgcaatgccggcatcatg
cgaccgagtccgtcggaagacatcacactcgacgatctcaatgccgttcttgccgtcaat
ctgacgagcgtcatcctgtgttcgcgtgcggtgctgaaatactggcgttcgaacgacctg
aaggggtcgatcctggtcaacagttccgtgcatcaggaaattcccaagccgcaatacctg
ggatactcagccagcaagggcgcggtcggcaatgtcgtccggacactcgcgctggaatac
gcggcgcatggcatccgcgtgaatggtgtcggtccgggtgcgatcgtgaccccgatgaac
gatgcctgggtgcatgatcccgaacagtacaagacagtgtccagccatatccccatgggc
cgtcccggtgaaggacgtgagattgccgacgcactgaccttcctcgcctcggaagaggcc
tcgtatatcaccggacagatgctctacgtggacggcggtctgaccctctacgccgatttc
cagaaaaactggtcatcgtga

DBGET integrated database retrieval system