KEGG   Neoasaia chiangmaiensis: A0U93_05620Help
Entry
A0U93_05620       CDS       T04705                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
nch  Neoasaia chiangmaiensis
Brite
KEGG Orthology (KO) [BR:nch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nch03009]
    A0U93_05620
Enzymes [BR:nch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A0U93_05620
Ribosome biogenesis [BR:nch03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A0U93_05620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF1062
Motif
Other DBs
NCBI-ProteinID: AQS89320
UniProt: A0A1U9KUJ5
Position
1193629..1194621
Genome map
AA seq 330 aa AA seqDB search
MTEPTLLTPPDAYTVTIDEAKAGQRIDRLLADQCDGLSRSRIKSLIEAGHLSSGGEVLRD
PSHATRVGQTFHLHIPPATPARPEAEHHALPILFEDRDLIVLDKPAGLVVHPAPGNESGT
LVNALLGHCGEDLEGIGGEKRPGIVHRLDKDTSGLMVVAKTPLAHNALSDAFARRDIDRA
YLALAWGLLPPESRFDGAIGRDKRDRKRMAVVTGTTGKPALTHVKLLETFQTGVSYIQCR
LATGRTHQIRVHLAHAGHPLLGDPIYLRRIPAAARQLAPDARRAALDFPRQALHATRLGF
IHPRSGERMSFETPPPDDFRTLLDALRSKG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagccaaccctgctgacgccacccgatgcctacaccgtgacgatagacgaggcg
aaggctggccagcgcatcgaccgtcttctggcggatcaatgcgacggcctgtcgcgttcc
cgcatcaagagcctgatcgaagccggtcacctatccagcggcggcgaggtgttgcgcgat
ccgtcgcatgccacgcgtgtcggccagacgtttcacctgcatatcccgcctgccacgccg
gcacgccccgaagcggaacaccatgcgctgccgatcctgttcgaggaccgcgacctgatc
gtgctcgacaagcccgccgggctggtcgtgcatcccgcgccgggcaatgaaagcggcacg
ctggtcaatgccctgctcggtcactgcggcgaagatctggaaggaatcggcggcgagaaa
cgccccgggatcgtacatcgcctggacaaggacacctcggggctgatggtggtcgccaaa
accccgctggcccacaacgccctctcggacgccttcgcacgacgggacatcgaccgtgcc
tatctggcgctggcctgggggttattgcccccggagagcagattcgatggcgcgatcggc
cgcgacaagcgtgatcgcaaacgcatggccgtcgtcacgggcacgaccggcaagccagcc
ctgacccatgtcaagctgctggaaacattccagacgggcgtgagctacatacaatgccgc
cttgccacaggccggacgcaccagatccgcgtacatctggcccatgccgggcatcctctg
cttggcgatccgatctatctgcgccggattccggccgccgcacggcagcttgcgcctgac
gcgcggcgggcggcactcgacttcccccggcaggccctgcatgcgacccgtctgggtttc
atccatccccgcagcggcgaacgaatgtcgttcgaaacccccccgcccgacgatttccgg
accctgctcgacgccctccgaagcaaaggttaa

DBGET integrated database retrieval system