KEGG   Neoasaia chiangmaiensis: A0U93_08250Help
Entry
A0U93_08250       CDS       T04705                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00260  Glycine, serine and threonine metabolism
nch01100  Metabolic pathways
nch01110  Biosynthesis of secondary metabolites
nch01120  Microbial metabolism in diverse environments
nch01130  Biosynthesis of antibiotics
nch01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A0U93_08250
Enzymes [BR:nch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A0U93_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQS89397
UniProt: A0A1U9KUL0
Position
1769738..1770784
Genome map
AA seq 348 aa AA seqDB search
MSEAIRKNFASDNIAPACPEVMDAMIRANSGPAPAYGGDEQSTTLEARFAELFEHDLRCF
PIATGTAANSLALAALVPPYGAVLCDQSAHIANDEGGAPEFFTHGAKLITIPSDDGRMLP
DALQTTIELNREGGIQSTPARALSLTQATEWGTVYSLARLRELTAIARQNNLPVHMDGAR
LANAVAHLDCSLADITWKLGIDVLSFGGTKNGAIAAEAVLFFNTALAEDFIRRIKRGGHL
WSKQRYLSAQLLPLLHDNLWLKHARQANAMAQRLAHGLRRQPGAKLPFEVQGNEVFVVLP
EPLVTQLEAAGYVFYRWPTPAGVDGTLIRLVTHYATEQTDVDALLASL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggcaatacgcaagaacttcgccagtgacaacatcgcaccggcctgcccggaa
gtgatggacgccatgataagggccaattccggccccgcccccgcctatggcggcgacgaa
cagtccacaacactcgaagcccgcttcgccgaactcttcgaacacgacctgcgctgcttc
cccatcgccaccggcaccgccgccaacagcctcgccctcgccgctctcgtgccgccctac
ggcgccgtgctgtgcgaccagagcgcccatatcgcgaacgacgaaggcggcgcgccggaa
ttcttcacccacggcgccaaactcatcaccatcccctcggacgacggccgcatgctgccg
gacgccctgcaaaccaccatcgaactgaaccgcgaaggcggcatccagtccaccccggcc
cgcgccctctccctcacccaggccacggaatggggcaccgtctacagcctcgcccggctg
cgcgaactcaccgccatcgcccgccagaacaacctgccggtgcatatggacggcgcacgc
ctcgccaacgccgtcgcccatctcgactgctccctcgccgacatcacctggaaactcggc
atcgacgtgctcagcttcggcggcaccaagaacggcgccatcgccgccgaggccgtcctg
ttcttcaacaccgccctggcggaggatttcatccgccgcatcaagcgcggcggccacctc
tggtccaaacaacgctatctcagcgcccagctcctgccgctcctgcacgacaacctctgg
ctgaaacacgcccgacaggccaacgccatggcccaacgcctcgcccacggcctccgccgc
cagcccggcgccaaactcccgttcgaggtccagggcaacgaagtcttcgtcgtcctgccc
gagcccctcgttacccaactggaagccgcaggctacgtcttctaccgctggcccacccca
gccggcgtcgacggcacgctcatccgcctcgtcacgcactacgccacggaacagacggat
gtggacgccctgctcgccagcctctga

DBGET integrated database retrieval system