KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_19525Help
Entry
BZZ01_19525       CDS       T04905                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BZZ01_19525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ncn01002]
    BZZ01_19525
Enzymes [BR:ncn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BZZ01_19525
Peptidases [BR:ncn01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BZZ01_19525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like
Motif
Other DBs
NCBI-ProteinID: ARV60529
UniProt: A0A1Y0RRU3
Position
complement(4814360..4815052)
Genome map
AA seq 230 aa AA seqDB search
MTNQPKHTIGLVIYPDMTQLDITGPHQVFSTMPDTRVLLLWKTLEPVVSNGGLTILPTTT
FDECPQLDVLCVPGGVFGAVEMMQDAQMLAFLRKQGETAQYVTAVCTGSLILAAAGLLRG
YKAATHWAFREQLALMGVEVSTERVIVDRNRITGGGITAGIDFALTLAGMLCGEDTAKFI
ELMLEYNPAPPFGVGSPSKANAELIETFKAFGAELIEASRTASLQAGGAY
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaccaaaacacactattggtttagtgatttatcctgatatgacccaacta
gatatcactggaccgcaccaagtcttttccacaatgcccgatactagggtattgctgctg
tggaaaaccttagaacctgttgtgagtaacggtgggctaacaattttaccaacgaccact
tttgatgaatgccctcaactggatgtgttgtgtgtaccgggtggtgtcttcggggcagtg
gagatgatgcaagatgcgcagatgttggcatttttgcgaaagcaaggagagacagcccag
tatgtcactgccgtttgtacgggttctttaattctagcggcagcaggtttgctgcggggg
tataaagcagctacgcactgggcatttcgcgagcaactggcattaatgggggtagaagtc
agtacagagcgagtcattgttgaccgtaaccggatcacaggcggtggcataacagcaggt
attgattttgccttgactcttgctggtatgctttgtggagaggatacagccaagtttatc
gaattgatgttggagtataatcctgcaccaccatttggagtgggctcaccttctaaagca
aatgcggaactgatagaaaccttcaaggctttcggggcagagttgattgaagcatcgcgt
acggctagcttacaagcaggaggtgcttattaa

DBGET integrated database retrieval system