KEGG   Nitrosomonas communis: AAW31_09390Help
Entry
AAW31_09390       CDS       T03942                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
nco  Nitrosomonas communis
Pathway
nco00430  Taurine and hypotaurine metabolism
nco00620  Pyruvate metabolism
nco00640  Propanoate metabolism
nco00680  Methane metabolism
nco01100  Metabolic pathways
nco01120  Microbial metabolism in diverse environments
nco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAW31_09390
   00640 Propanoate metabolism
    AAW31_09390
  09102 Energy metabolism
   00680 Methane metabolism
    AAW31_09390
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AAW31_09390
Enzymes [BR:nco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AAW31_09390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKH37979
UniProt: A0A0F7KGQ3
Position
2074152..2075360
Genome map
AA seq 402 aa AA seqDB search
MSNSIILVVNAGSSSLKFSVFRVNGAENLPLVIRGQMDGIGTRPYLKVRDANETMLVESD
LTTSEAATVGDAITLVGAWLRERLQHESLFAVGHRVVHGGTQFSHPVLVDREVLMALEQL
IPLAPLHQPHNLAAIRAIGERQPQIPQVACFDTAFHRTHPQIADLYALPWKYYESGVRHY
GFHGLSYEYIALILPKMAPEIANGRVIVAHLGSGASLCALRAGKSIDSTMGFSPLDGVPM
GTRPGALDPGVLLYLVNQCGLSGGELETLLYKESGLLGLSGISNDMRILLESQESRAQLA
VEYFVHYTVKQIGALAAVLGGVDGIVFTAGIGEHSPVIRARILQACAWLGVSVDTAANER
SDSCISSTDSKVSAWVIPTNEELMIARHTLALINSRKGGHVE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagtatcattctggtcgtcaatgccggttcatccagcctgaaattttcagtg
tttcgcgtaaatggcgctgaaaatttaccattggtaatccgcgggcagatggatggcatt
ggtactcgtccgtatttgaaggtaagagatgctaacgaaacaatgctggttgaatctgat
cttaccacttcggaagcggctacagttggagatgccattacgctcgtcggcgcctggctg
cgcgagcgcttgcaacatgagtcgctattcgccgtggggcatcgtgtagtacatggcggt
acccaattttcccatcctgtgctggttgatcgcgaggtattgatggcgctggagcagttg
attccgcttgctcctttgcatcaacctcataatctggctgcgatccgcgcaatcggcgaa
aggcaaccacagataccgcaggtggcttgtttcgatacggcatttcaccgcacccatccg
cagattgctgatctttatgcattgccttggaaatactatgaatccggggtgagacactat
ggtttccacggcctgtcatacgaatatatcgcgctcatattgccgaagatggctcctgag
attgctaatggacgggtgatcgtggcccatcttggcagtggcgcaagcttatgtgccttg
cgagcaggcaaaagtattgattcgactatgggattttcgccgcttgatggggtgccgatg
gggacgcggccgggtgcgctggatccaggcgtattgctgtatctcgtcaatcagtgtggc
ttgtcagggggcgaactggaaacgctgttatataaagagtcagggctgctggggttgtct
ggcattagcaacgatatgcgcatcctgctggaaagtcaggagtcacgcgcgcaattggct
gtggagtatttcgtgcattacaccgtcaaacagatcggtgcgcttgctgcggtgctcggc
ggagtagatggcatcgtgtttacagccgggattggcgagcattcaccggtgatccgggca
cgcattctgcaggcctgtgcttggctaggtgtgtcggtcgataccgccgccaatgagcga
agtgactcgtgcatctcgtcaacagacagcaaggtctcagcctgggtgattcctaccaat
gaggaactgatgatcgcgcgccatacgctggcactgataaacagtcgaaagggtggacat
gttgagtga

DBGET integrated database retrieval system