KEGG   Nitrosomonas communis: AAW31_13520Help
Entry
AAW31_13520       CDS       T03942                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nco  Nitrosomonas communis
Pathway
nco00450  Selenocompound metabolism
nco00970  Aminoacyl-tRNA biosynthesis
nco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AAW31_13520
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AAW31_13520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nco01007]
    AAW31_13520
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nco03016]
    AAW31_13520
Enzymes [BR:nco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AAW31_13520
Amino acid related enzymes [BR:nco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AAW31_13520
Transfer RNA biogenesis [BR:nco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AAW31_13520
 Prokaryotic type
   Other AARSs
    AAW31_13520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AKH38585
UniProt: A0A0F7KDG9
Position
complement(2989947..2992070)
Genome map
AA seq 707 aa AA seqDB search
MNTRKMLITSALPYANGSIHLGHLVEYIQTDIWVRFQKMQGHTVYYVCADDTHGTPIMLR
AEKEGMTPEALIARVHGEHLRDFTGFHIQFDNYYSTHSPETRQYSEDIYQKLKAMGLIKV
RAIEQLYDPVKNMFLPDRFVKGECPKCGAQDQYGDSCEACGAAYAPTELKNPYSAVSGAA
PVKKASEHFFFSLSDSRCADFLRRWTREANHLQAEAANKMHEWLGEAGENKLSDWDISRD
APYFGFEIPGESGKYFYVWLDAPIGYMGSFKNLCAQRGIDFDEFWQKDSTTELYHFIGKD
ILYFHALFWPAMLENSGYRTPTQIFAHGFLTVNGEKMSKSRGTFITAESYLQQQLNPEWL
RYYYAAKLNGTLEDIDLNLEDFTARVNSDLVGKYINIASRCAGFITKRFDGKLVAGEEYR
TLQQMIDERFASWQSGVIEQAYEERDFSAAVRQIMKRADEVNELIQELAPWDIAKETARN
NELHLACSLGIQLFYLLSCYLKPILPATAARIEHFLNCASLLWPKQETGQALSTVLLPAG
HVINPYQHLMTRIDAKQINALIEANKQTIAPASDSHSRVRHSEAQQHIQQRAITPIAEII
SIDDFSKIDLRIARIVNAEHVEGAEKLLKLTLDIGAEQRTVFAGIKSAYDPEKLKGRLTV
MVANLAPRKMKFGLSEGMVLAASDEGSGGGLFLLSPDEGAQPGMRVK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacgcaagatgctgattacttccgcgctgccttatgctaacggcagcattcac
cttggccacctggtggaatatattcaaaccgatatctgggttcgcttccagaaaatgcaa
gggcacaccgtttactacgtgtgtgctgatgatacacatggtacgcctatcatgctgcgc
gccgagaaagaaggcatgacgccggaagcactgattgcccgggtgcatggtgagcatttg
cgtgattttaccggctttcatatccagtttgataactactacagtacgcattcaccagag
acccgtcagtattcggaagacatttaccagaaactgaaagccatggggcttatcaaagtg
cgcgccattgagcagctttatgatccagttaagaatatgtttctgccggatcgtttcgta
aaaggggaatgcccaaagtgcggtgcgcaagatcagtatggtgattcctgcgaagcctgt
ggcgcagcctatgcgccgacagaattaaaaaatccttactctgcggtttcgggtgcggcc
cccgtgaaaaaagcctctgagcatttctttttcagtttatccgatagccgctgtgcagat
ttcctgcgccgttggacacgggaagctaaccatctgcaagcagaagcggccaacaaaatg
cacgaatggttaggggaggctggagaaaacaaactgtctgactgggatatctcacgtgat
gcgccgtattttggctttgaaatacccggtgaatccggcaaatatttttacgtctggctt
gatgcgcccattggttatatgggcagtttcaaaaatttgtgtgcgcagcgtggcatcgat
tttgatgaattttggcagaaagatagcactaccgagctgtatcattttatcggcaaagac
atcctgtattttcatgcgctcttctggccggccatgctggagaattcaggctatcgcaca
cccacccagatttttgcgcatggttttcttactgtgaatggtgaaaagatgagcaaatca
cgtggtacctttattactgcggaaagctatttacagcaacagcttaatccggaatggctg
cgttattactatgctgctaaactgaacggcacactggaagatatcgatctcaatctggaa
gatttcaccgcacgcgtgaattcggatctggtcggcaagtacatcaatatcgccagccgc
tgcgcaggattcattactaaacggtttgacggtaaactggtagcgggcgaagaatatcgc
acgttgcagcaaatgatcgatgagcgcttcgcttcctggcagtctggcgttatcgaacaa
gcctatgaagagcgggatttttctgccgccgtgcggcaaatcatgaagcgcgcagatgaa
gtaaacgaactgattcaagagctggcgccctgggacatcgccaaagagactgcgcgcaac
aacgaattacatctggcctgcagcctgggcattcaactgttctatttgctttcgtgttac
ctgaaaccgattctgcctgccacagcagcaagaattgaacatttcctcaactgcgcatca
cttctctggccgaaacaagaaaccggccaagctttatctaccgtgctcttgcctgcaggg
cacgtgatcaatccctaccagcatctgatgacgcgcattgatgctaaacaaatcaatgca
ttgattgaagccaataaacaaactattgccccagcttctgattctcactcacgcgtgcgt
cattcagaagcgcaacagcatatccagcaacgcgcgattacaccgatcgcagaaatcatc
tcgatcgacgatttcagcaagatcgatctacgcattgctcgcattgttaatgccgaacat
gtggaaggtgcggagaaactactcaaactgaccttggatattggcgcagagcagcgcacc
gtgtttgctggtattaagtcagcttatgatccagaaaagcttaaaggtcgtctcaccgtg
atggtcgctaacctcgcgccgcgaaaaatgaaatttggtttgtcggaagggatggtgctg
gcagcaagtgatgagggcagtgggggagggctgtttttactttcacccgatgagggtgcg
cagccggggatgcgggtgaaataa

DBGET integrated database retrieval system