KEGG   Neurospora crassa: NCU00944Help
Entry
NCU00944          CDS       T01034                                 

Gene name
thr-5
Definition
(RefSeq) threonine-5
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ncr  Neurospora crassa
Pathway
ncr00260  Glycine, serine and threonine metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCU00944 (thr-5)
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NCU00944 (thr-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 3881289
NCBI-ProteinID: XP_965137
UniProt: Q7SGH8
Position
I
AA seq 470 aa AA seqDB search
MPAESHGKRSRARRADHLCPVSNGDSDVISSPLQSTMPAQASRAVARQLCIAGRHQQPLR
LSFRTPVVLSSVRQSCGFSSTTPFKMGQSDVQNAWVGSAGPGAFDLRSDTMTTPTASMLA
AIQSCSLLDDVMQEDPTTSDLEAHCAALCGKEAGLLVLSGTMGNQLAMRSLLTQPPHGVL
CDARCHIVKYEAGGVSSLTGAMLKPVMPSNGVYLTLEDVKANIHLDDDVHTCPTRVLELE
NTLNGMIMPLSEVRRISAFAREHGIKMHCDGARLWEAVASGAGSLAEFAKCFDTISLCFS
KGLGAPIGSMLVGPKDVIKHARWVRKSIGGGLRQSGVVAAAARVAVDETFGKGPSGEGGK
LKGAHILAKEIERIWTGLGGKLLHPVDTNMVWLDLNDAKCSAERMNELGKESGLKLWAPR
LVISYQVFENRDHVIPKLESIFETIMQEKTTKTGEGFQKADGEISQYRSK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagagtcacacgggaagaggtctagagctcgccgggctgaccacctctgtccg
gtgtccaacggtgattctgacgtgatttcttcgccacttcaatcgaccatgccggctcag
gcctcaagagcagttgcccgacaactttgcatcgctggtcgacatcaacaacctttacgc
ttgtcgttcagaaccccggtggttctttcgtccgttcgacagtcctgtggtttctcgtca
acaacacccttcaagatgggccagtcagatgtgcaaaatgcctgggttggcagcgccggc
ccgggagcctttgatctccgcagtgataccatgacaactcccacggcgtccatgcttgcc
gctatccagtcctgctctctgctcgacgatgtcatgcaagaagatcccaccaccagcgac
cttgaggcccactgcgctgctttgtgcggcaaggaggccggcctcctcgttttgtcaggc
accatgggcaatcagctagctatgaggtccttgctcacccaaccgcctcacggtgtgctc
tgcgatgcccgctgccacattgtaaaatatgaggctggaggtgtctcatctctaacgggc
gccatgctcaagcctgtcatgcctagcaacggcgtctaccttaccctcgaagacgtcaag
gccaacattcatctcgatgacgacgtgcacacttgcccgactcgcgttctcgagctcgag
aacacactcaatggcatgatcatgccgctctccgaggtgcgccgcatctccgcctttgct
cgcgagcatgggatcaagatgcactgcgacggcgcgcgcttgtgggaggcggtggcctct
ggtgctggaagccttgccgaatttgcaaagtgctttgacacaatcagcctatgcttctcc
aagggccttggagcacccattggcagcatgctggtaggccccaaggacgtgatcaagcat
gcccggtgggtaagaaagtcgattggcggtggactaagacagtcgggcgtcgtggcggct
gctgcgagggttgccgttgacgaaacgtttggcaaggggcccagtggcgaaggcggcaag
ttgaagggagcgcatattttggccaaggagatcgagaggatatggacgggcttgggcggc
aagcttcttcatcctgttgacaccaacatggtgtggctcgatttgaacgatgcgaagtgt
tcggcggagaggatgaatgagctcggcaaagaatcgggactcaagttatgggcacctcgc
ttggtcatcagctaccaggtttttgaaaaccgtgaccatgtaatacccaagctggagagc
atcttcgagacgatcatgcaggagaagacaacaaagacgggagaaggttttcagaaggct
gatggagagatatcgcaatatcggagcaaatag

DBGET integrated database retrieval system