KEGG   Neurospora crassa: NCU01435Help
Entry
NCU01435          CDS       T01034                                 

Gene name
stk-1
Definition
(RefSeq) serine/threonine protein kinase-1
  KO
K15562  serine/threonine-protein kinase BUR1 [EC:2.7.11.22 2.7.11.23]
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncr01001]
    NCU01435 (stk-1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ncr03021]
    NCU01435 (stk-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     NCU01435 (stk-1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     NCU01435 (stk-1)
Protein kinases [BR:ncr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   NCU01435 (stk-1)
Transcription machinery [BR:ncr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    BUR kinase complex
     NCU01435 (stk-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 3872142
NCBI-ProteinID: XP_955995
UniProt: Q871M9
Position
Linkage Group V; V
AA seq 559 aa AA seqDB search
MSIDEAKEGGGGPAMSPRAFALAHQRDRGSFVGCSRIADYEVLGKLGEGTFGEVHRARSR
KTGALVALKKIIMHNERDGFPITALREIKLLKLLSHKNVLRLEEMAIEHPPRTDKRTRPI
VYMVTPYMDHDLSGLLDNPSVRFTEPQVKCYLLQLLEGLKYLHANHILHRDMKAANLLIN
NKGVLQIADFGLARHYEGDIPQPGKGSGEGKRDYTSLVVTRWYRPPELLMHLKRYTTAID
MWGVGCVFAEMLEGKPVLQGESDLHQLELVWDLCGTPSEETMPGWRTLPGGQAFSSKPRP
GNLARRFEKHGPVVISLLKELFKLDWRSRINAIDALNHPYFRTAPLPALPGDLPTFEESH
EFDRRKFQDRKAALPPAPKGGTVGRGAVVNSQGPDTGFSGRDGYGGGGRNGANGGRYPPY
HRGPPPGDERVPSWHSARGLPPRPPMPADYHGSGPMDHTDGYRDRPPRRGPGGPPGGGGG
PSNVDTYIPSYDRDGPAPRREDWRRRDDWDDRRGGVDRDRRRPEYDVRSRDSRTRSRTRS
RSPVRDRDRGRDRDAYARR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgacgaggcaaaggagggcggcggaggccctgccatgtctcctcgcgctttt
gcgcttgcgcaccagagggacaggggcagcttcgtgggctgctctaggattgccgactat
gaagtcctgggtaaactgggcgagggtacctttggcgaggttcaccgcgcgaggtcgagg
aaaacgggcgccttggtcgcactcaagaagatcatcatgcacaacgagagagatgggttc
cccatcaccgctcttcgagaaatcaagttgctcaagcttctctcgcacaaaaacgtcttg
cgcctagaggagatggcgattgagcatccacccagaaccgacaagcgaacaagacctatc
gtatacatggtcacaccctacatggaccacgatttatccggcttgctcgataacccgtca
gttcgcttcactgaaccacaagttaaatgttacttgctgcagttgctagaaggtctcaag
tatctgcacgcgaaccacattctgcacagagatatgaaggcggccaatcttctcatcaac
aacaagggtgtactacagattgccgactttggtctagcgaggcattacgagggcgacatt
ccccaacccgggaagggaagcggcgaggggaagcgtgactacactagcttggtggtgacc
agatggtaccgccctcccgagcttctgatgcatctcaaaaggtacaccacagcaatagat
atgtggggtgttggatgcgtattcgcagagatgctggaaggaaagccagtcctacagggc
gagagcgatcttcaccagttagagcttgtttgggacctctgcggaacaccatctgaggag
acgatgccgggatggaggacgttacccggtggccaggcattctcgtcaaagcctaggcca
ggaaatctggcacgcagatttgagaagcacggacccgtggttatttcgctgcttaaggag
ctgttcaagcttgactggaggtcacgcatcaacgcgattgatgctctcaaccacccatat
ttccggactgcgccactaccagctctacctggcgatttaccaacgttcgaggagagtcac
gaattcgacaggcgcaagtttcaagacaggaaagcggcattgccgcctgcgcctaaggga
ggcacggtgggccgcggggctgttgttaacagccaaggcccagataccggatttagcggt
agggatggttacggcggtggtggtcgtaatggggcaaacggcggcagatacccgccatac
caccgtggtcccccaccaggcgacgagcgagttccctcgtggcatagtgcacggggattg
cctccacgacctccgatgcccgcagactaccatggcagcgggccgatggaccacaccgat
gggtaccgtgaccgtccaccacgtagaggtcccggcggaccgcccggagggggaggtggt
ccgagcaacgtagacacttacatccccagctacgaccgcgacggacccgcgccgcgccga
gaggactggcgccgccgtgatgactgggatgacaggcgaggtggagtggaccgggataga
agacggccagaatatgacgttaggagccgggacagcaggacgaggagccgaacacgcagc
agatccccggtccgtgaccgcgatcgaggtcgggaccgcgatgcatatgcgcgaagatag

DBGET integrated database retrieval system