KEGG   Neurospora crassa: NCU01441Help
Entry
NCU01441          CDS       T01034                                 

Definition
(RefSeq) inosine triphosphate pyrophosphatase
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
ncr  Neurospora crassa
Pathway
ncr00230  Purine metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCU01441
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     NCU01441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 3872114
NCBI-ProteinID: XP_955963
UniProt: Q1K4R6
Position
Linkage Group V; V
AA seq 191 aa AA seqDB search
MSAPSQARHIVNFITGNANKLGEVKAILEPAIQVENQALDLLEIQGTLEEVTLDKCRRAA
DLVQGPVLVEDTCLCFNALKGLPGPYIKWFMNSLGHEGLNNLLAAYEDKSAKAVCTFGYS
AGPGHEPILFQGITDGKIVPPRGPPNFGWDAIFEYEGQTYAEMDKAEKNKISHRAKALAK
LQEWFAKEMTA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccttcacaagcccgccacatcgtcaacttcatcaccggcaatgccaacaag
ctcggtgaagtcaaggcgatcctcgagcccgccatccaggtcgagaaccaggcgcttgat
ctgctcgagatccagggcaccttggaggaagtcacgttggataagtgccggagggctgct
gatttggtccaaggccccgttctcgtcgaagatacctgcctctgcttcaacgctttgaag
ggtcttcctggtccttatatcaaatggttcatgaactccctcggccatgaaggcctcaac
aacctcctagccgcttacgaggataagtcggctaaggccgtctgcacctttggctactct
gctggtcccggccacgagcccattctcttccagggcatcaccgacggcaaaatcgttcct
ccgaggggtcctcctaacttcggctgggacgccatcttcgagtatgaaggccagacatat
gccgagatggataaggcggaaaagaacaagatttcccaccgcgccaaggctctggccaag
ttgcaggagtggtttgctaaggagatgaccgcttga

DBGET integrated database retrieval system