KEGG   Neurospora crassa: NCU01680
Entry
NCU01680          CDS       T01034                                 

Gene name
pma-1
Definition
(RefSeq) plasma membrane ATPase-1
  KO
K01535  H+-transporting ATPase [EC:7.1.2.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00190  Oxidative phosphorylation
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCU01680 (pma-1)
Enzymes [BR:ncr01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.1  P-type H+-exporting transporter
     NCU01680 (pma-1)
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 3873048
NCBI-ProteinID: XP_956886
UniProt: P07038
Structure
PDB: 
1MHS

Position
Linkage Group II; II
AA seq 920 aa
MADHSASGAPALSTNIESGKFDEKAAEAAAYQPKPKVEDDEDEDIDALIEDLESHDGHDA
EEEEEEATPGGGRVVPEDMLQTDTRVGLTSEEVVQRRRKYGLNQMKEEKENHFLKFLGFF
VGPIQFVMEGAAVLAAGLEDWVDFGVICGLLLLNAVVGFVQEFQAGSIVDELKKTLALKA
VVLRDGTLKEIEAPEVVPGDILQVEEGTIIPADGRIVTDDAFLQVDQSALTGESLAVDKH
KGDQVFASSAVKRGEAFVVITATGDNTFVGRAAALVNAASGGSGHFTEVLNGIGTILLIL
VIFTLLIVWVSSFYRSNPIVQILEFTLAITIIGVPVGLPAVVTTTMAVGAAYLAKKKAIV
QKLSAIESLAGVEILCSDKTGTLTKNKLSLHDPYTVAGVDPEDLMLTACLAASRKKKGID
AIDKAFLKSLKYYPRAKSVLSKYKVLQFHPFDPVSKKVVAVVESPQGERITCVKGAPLFV
LKTVEEDHPIPEEVDQAYKNKVAEFATRGFRSLGVARKRGEGSWEILGIMPCMDPPRHDT
YKTVCEAKTLGLSIKMLTGDAVGIARETSRQLGLGTNIYNAERLGLGGGGDMPGSEVYDF
VEAADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGSSDAARS
AADIVFLAPGLGAIIDALKTSRQIFHRMYAYVVYRIALSIHLEIFLGLWIAILNRSLNIE
LVVFIAIFADVATLAIAYDNAPYSQTPVKWNLPKLWGMSVLLGVVLAVGTWITVTTMYAQ
GENGGIVQNFGNMDEVLFLQISLTENWLIFITRANGPFWSSIPSWQLSGAIFLVDILATC
FTIWGWFEHSDTSIVAVVRIWIFSFGIFCIMGGVYYILQDSVGFDNLMHGKSPKGNQKQR
SLEDFVVSLQRVSTQHEKSQ
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggcggaccactcggccagcggcgctcctgcgctgtcgaccaacatcgagagcggaaag
ttcgacgagaaggcggcggaggctgccgcttaccagcctaagcccaaggttgaggacgat
gaggatgaggacatcgatgccctcattgaggatctcgagtcccatgatggacacgatgct
gaggaggaagaagaggaggccactcctggtggcggccgtgttgtccccgaggacatgctc
cagactgacacccgtgtcggtctcacatccgaggaggttgtccagcgccgtcgcaagtac
ggtctcaaccagatgaaggaggagaaggagaaccacttcctcaagttcctcggtttcttc
gtcggtcccattcagttcgtcatggagggtgctgccgtccttgctgctggtctcgaagac
tgggttgatttcggtgtcatctgcggtttgttgcttcttaacgccgttgtcggtttcgtt
caggaattccaggctggttctatcgtcgacgagttgaagaagactcttgctctcaaggct
gtcgttctccgtgatggtactctcaaggagattgaggcccccgaggtcgttcccggtgat
atcctccaggttgaggagggtaccattatccccgctgatggtcgcatcgtcaccgatgat
gctttcctccaggttgatcagtctgctcttaccggcgagtctcttgctgtcgacaagcac
aagggtgaccaggtcttcgcttcctccgctgtcaagcgtggtgaggctttcgtggtcatc
accgccaccggtgacaacaccttcgtcggtcgtgccgctgccctcgtcaacgctgctagc
ggtggctctggtcacttcactgaggttctgaacggtatcggtaccattctcctcatcctc
gtcatcttcactctcctcatcgtctgggtttcctcgttctaccgttccaaccccatcgtc
cagatcctcgagttcacccttgccatcaccatcatcggtgtccccgtcggtcttcccgct
gtcgtcaccaccaccatggctgtcggtgccgcctacctcgccaagaagaaggccatcgtc
cagaagctctccgctatcgagtcccttgctggcgtcgagattctctgctctgacaagact
ggtaccctcaccaagaacaagctctccctccacgacccctacaccgtcgctggtgtcgac
cccgaggatctcatgcttactgcctgcttggccgcttcccgcaagaagaagggtattgat
gccatcgacaaggctttcctcaagtccctcaagtactacccccgcgccaagtccgttctc
tccaagtacaaggttctccagttccaccccttcgaccccgtctccaagaaggtcgtcgcc
gttgtcgagtctccccagggtgagcgcatcacttgcgtcaagggtgcccctcttttcgtt
ttgaagactgtcgaggaggaccaccccatccccgaggaggttgaccaggcctacaagaac
aaggttgctgagttcgctacccgtggtttccgttctcttggtgttgcccgcaagcgtggc
gagggctcttgggagattctcggtattatgccctgcatggaccctccccgtcacgatacc
tacaagactgtctgcgaggccaagactctcggtctctccatcaagatgcttactggtgat
gccgtcggtattgctcgcgagacttctcgccagctcggtctcggtaccaacatctacaac
gctgagcgcctcggtcttggtggtggtggtgacatgcccggctctgaggtctacgacttc
gttgaggctgccgatggtttcgccgaggtcttcccccagcacaagtacaacgtcgtcgag
attcttcagcagcgtggctaccttgttgccatgactggtgacggtgtcaacgatgctccc
tcgctcaagaaggccgatactggtattgctgtcgagggttcctccgatgctgcccgctcc
gctgccgatatcgtcttccttgcccctggtctcggtgccatcattgatgccctcaagact
tctcgccagattttccaccgcatgtacgcctacgttgtctaccgtatcgctctgtctatc
cacttggagatcttcctcggtctctggatcgccattctcaaccgttccctcaacattgag
cttgttgtcttcatcgccattttcgccgatgttgccacccttgccattgcctacgacaac
gccccctactcgcagacccccgtcaagtggaaccttcccaagctctggggtatgtccgtc
ctcctcggtgtcgtccttgccgtcggtacctggatcactgtcaccaccatgtacgctcag
ggtgagaacggcggtatcgtccagaacttcggtaacatggacgaggtcctcttcctccag
atctctctcactgagaactggctcatcttcatcactcgtgccaacggtcccttctggtcc
tctatcccctcgtggcagctcagcggtgctatcttcctcgttgatatccttgccacctgc
ttcaccatctggggttggttcgagcactccgacacctccatcgtcgccgttgtccgtatc
tggatcttctccttcggtatcttctgcatcatgggcggtgtctactacatcctccaggac
agcgttggcttcgataaccttatgcacggcaagtcccctaagggcaaccagaagcagcgc
tcgcttgaggactttgttgtctctctccagcgtgtctctactcagcatgagaagtcgcaa
taa

DBGET integrated database retrieval system