KEGG   Neurospora crassa: NCU02193Help
Entry
NCU02193          CDS       T01034                                 

Gene name
cfp
Definition
(RefSeq) cellular filament polypeptide
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00010  Glycolysis / Gluconeogenesis
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU02193 (cfp)
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     NCU02193 (cfp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 3875734
NCBI-ProteinID: XP_011395109
UniProt: P33287
Position
Linkage Group VII; VII
AA seq 570 aa AA seqDB search
MVAQQQGKFTVGDYLAERLAQVGVRHHFVVPGDYNLILLDKLQAHPDLKEVGCANELNCS
LAAEGYARANGISACVVTYSVGALSAFNGTGSAYAENLPLVLISGSPNTNDPSQYHILHH
TLGHPDYTYQYEMAKKITCCAVAIPRAIDAPRLIDRALRAAILARKPCYIEIPTNLAGAT
CVRPGPISAITDPITSDKSALEAAAKCAAEYLDGKLKPVILVGPKAGRAGSEKELIEFAE
AMGCAVALQPAAKGMFPEDHKQFVGIFWGQVSSDAADAMVHWADAMICVGAVFNDYSTVG
WTAVPNIPLMTVDMDHVTFPGAHFSRVRMCEFLSHLATQVTFNDSTMIEYKRLKPDPPHV
HTAEREEPLSRKEISRQVQEMLTDKTSLFVDTGDSWFNGIQLKLPPGAKFEIEMQWGHIG
WSIPAAFGYALRHPDRHTIVLVGDGSFQVTAQEVSQMVRFKVPITIMLINNRGYTIEVEI
HDGSYNKIKNWDYAMLVEAFNSTDGHAKGLLANTAGELADAIKVAESHKEGPTLIECTID
QDDCSKELITWGHYVAAANARPPRNMSVQE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtagcccaacaacaaggaaagttcacggtgggcgactacctcgccgagcgtcttgct
caggtcggcgtccgccaccactttgtcgtccccggcgactacaacctcatcctcctcgac
aagctacaagctcacccggatctcaaagaggttggttgcgccaacgagctcaactgctct
cttgccgccgaaggctatgcccgtgccaacggcatctccgcctgcgttgtcacttacagc
gttggtgccctctcggccttcaacggcaccggcagtgcctacgcagagaacctccccttg
gtcctcatcagcggctcgcccaacaccaacgaccccagtcaatatcacatccttcaccat
accctcggccacccggactacacctaccagtatgagatggccaagaagattacctgctgc
gctgtggccattccccgcgccatcgatgcaccccgcctgatcgaccgtgccctccgcgcc
gccatccttgcccggaagccctgctacatcgagatccccaccaacctcgccggagctacc
tgcgtgcgccccggccccatcagcgccatcaccgaccccatcaccagcgacaagagcgct
cttgaggccgccgccaagtgcgctgccgagtatctcgacggcaagctcaagcccgtcatc
ctggttggccccaaagctggccgtgccggttccgagaaagagctcatcgagttcgccgag
gccatgggctgtgctgttgccctgcaacctgccgccaagggcatgttccccgaagaccac
aagcagttcgtcggcatcttctggggacaagttagctccgatgccgcagacgccatggtg
cactgggccgacgccatgatttgcgtcggcgccgtctttaacgactacagcacggtcgga
tggactgccgtgcccaacatcccgctcatgaccgtcgatatggatcatgtcaccttcccc
ggcgcacacttcagccgcgtccggatgtgcgaattcctcagccacctggccacccaggtc
accttcaacgactccaccatgatcgagtacaagcgcctcaagcccgaccccccgcacgtg
cacacggccgaacgcgaggagccgctctcgcgcaaggagatctcgcgacaggtgcaggag
atgttgacagacaagaccagcctgttcgtcgacacgggcgactcgtggttcaacggcatc
cagctgaagcttcctcctggcgccaagttcgagatcgagatgcaatggggccacatcggc
tggtcgatccctgcggcctttggctacgccttgcgccaccctgacaggcacaccattgtg
ctggtcggcgacggatctttccaggtgacggcccaggaggtgtcgcagatggtgcgcttc
aaggtacccatcaccatcatgctcatcaacaaccgcggctacacgatcgaggtcgagatc
cacgacggttcctacaacaagatcaagaactgggactacgccatgttggtggaggccttc
aacagcaccgacggccacgcaaagggcctgctggccaacacggccggcgagctcgctgac
gctatcaaggtggctgagagccacaaggagggtcctacgctgatcgagtgcacgattgat
caggatgactgcagtaaggagctcatcacctggggtcattacgtggctgctgcgaatgcg
aggcctccccgcaacatgtcggtgcaggagtaa

DBGET integrated database retrieval system