KEGG   Neurospora crassa: NCU02387Help
Entry
NCU02387          CDS       T01034                                 

Definition
(RefSeq) nuclear import and export protein Msn5
  KO
K14289  exportin-5
Organism
ncr  Neurospora crassa
Pathway
ncr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    NCU02387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ncr03016]
    NCU02387
   03036 Chromosome and associated proteins [BR:ncr03036]
    NCU02387
Transfer RNA biogenesis [BR:ncr03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    NCU02387
Chromosome and associated proteins [BR:ncr03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     NCU02387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N HEAT_2
Motif
Other DBs
NCBI-GeneID: 3875854
NCBI-ProteinID: XP_959707
UniProt: Q7S4P7
Position
Linkage Group VII; VII
AA seq 1276 aa AA seqDB search
MDTNGAAGAGADPVIARIHEALNIVHSPYSPNQARQEAQAFLEEVKTRGDAPSHGFSLAS
GGSQEPVVRHYGLSLLEYAVKHKWSEYDTNQREFLRGWILQLAQGVAKSDPPFLRTKMAQ
LWVEIAKRCWVAEWMDMDELLNRLWQVPGSSVHKEFVLLILEILSEEIFNGEDAIVAHRE
GALSKGCVEIFTPSAVLSEAFPTRQHEPQVRFGDDGWISRVTELVRDCLNENLDSNEDVR
ACVVKALAVLNSVMPWAIPKAIHATGCRPVICNGLANSNVTVQRAALEALHSLYSRSAFS
SEEFVDLVVPMYSPESVDLCRRLFEWSTVDAEDIDDDKYQFAKKFSEMISCVGNYLDRKY
ASIPPQVDIQDFLKLLIAVVQSQSLVVSIPVLVTWTRLLNHRSLGPAIGKTDMVLPLLDV
CSSRLLRYENLPEDTEDPTFVLLMEDTDTIPERHAFLGNYRRYSCSIIESIIQLRLTDAF
QYILSQAENALQTLYEGQPPLNPATYLKNSMPVLRVDAHATVIEAALKGYVKWRARQGEL
PGGDQEISSIETHLEQWCSRLLEMNIEDPLIRKRILQLLVAFSTTALDTKANFMLRVLEH
ILMTWPALQPEHKTFNDAIRDLQTESMVELQRLASKMPDHLLDVYDQLEVKVKEMIASGT
LDEKRQIAYRSFLFIIIHRATRIDQETRIRRLAEFVEPVKNQWKEAPLRQSLSSFEGFCQ
LIGLDKAQNYIAQRRVHQVGDWGAVELDAEGLALQAELEQRQTFLPLRSTKSFLTYSVEK
LEKNSPAYQASCALWQDGFPTILPELLKFLSYAHACHDPKNWSLLPEDMRPVVSRLLTDR
FWQAGISEGSKDDFYARVLDKKNTLEGLASTIRGTVRFVREACYAVIYCMSRLDVQFYGF
TELPGPLANALFADSFSLSSHQLINLLNLVRYLVDHCPVELRDHFLPPILAACFQQMDAK
ISSEWEKLGQKQTVQVADNEELTEEMKAESILRQLTYTAAIMVAEFLDPARTGPPSNLPA
SPNGTTPESRYPSLRRFCLMQTSIAGPLLLFLCHAIHMRDTRCCGVVLRVFRSIVPEFQI
QTGQPREQKEPSHPVLPDENYPIPDATKAEIHQFLCTDVMRAAISSMNDPYFVDTQKDLA
TLIATILSHYCVGDDFSGGNSAPRQILCSLPGIKEQEVDRTLTFLRRPGTHSRQQRAVVL
DLLRNVKSVSISEMGKLKDPREDLVKKAPKRSKMAQKFMTPQQGADTSVTGTEQGTGKRQ
ATPDLEGVAGMFDEGH
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaacggggccgccggtgccggcgccgatcccgtcatcgcgaggattcacgaa
gcgctcaacattgtccacagcccctactctcccaaccaggcccgacaggaagctcaggca
tttctggaagaagtcaagacccgcggtgacgcgccctcgcacgggttcagccttgcttcc
ggaggctctcaagaacccgtcgttcgccactacggcctgtctcttctcgaatatgcggtc
aagcacaagtggtccgaatatgacaccaaccaacgcgagtttctccgcggttggatcttg
caactggcacagggtgtcgcaaaatcagatccgccctttctcagaacaaagatggcccag
ctctgggtcgagatagctaagcgctgctgggttgcggagtggatggatatggacgagttg
ctgaaccgcctatggcaggttccgggctcatccgtgcacaaggagttcgtgctcctgatt
ctcgaaatcttgtccgaggagattttcaacggagaagacgccatcgttgctcatagagag
ggagcgctgagcaaggggtgcgttgagatcttcaccccttctgcagtgctcagcgaagcc
ttcccaacccgtcaacacgaaccccaggtgcgattcggtgacgacggatggatcagtaga
gtaacagaactcgtccgagactgtttgaacgagaacctcgacagtaatgaggacgtccgg
gcctgtgtcgtcaaagctttggccgttctcaactccgtgatgccttgggcaataccaaaa
gccattcatgctaccggttgccgtcctgttatatgcaatggccttgccaactcaaacgtg
accgtgcaaagggctgctttggaggcgttgcattctctctattcccggtcagcattcagc
agcgaagagttcgtcgatctggttgttcccatgtacagccccgagtcggtcgacctctgc
agacgactttttgaatggtcgacagtggacgctgaggacattgacgacgacaagtaccag
tttgccaagaaattctccgagatgatctcgtgtgttggaaactaccttgaccggaagtac
gcttccatacctccccaggttgacattcaggacttcctgaagcttctaatagcagtggtg
cagagtcagagcctcgttgtctccattcccgtcctcgtgacctggacgcgccttcttaac
caccgctcgctaggtcccgctatagggaaaactgacatggttctccccctactggacgtc
tgtagctctcggctgttgcgctatgagaaccttcctgaagatacggaagatcctacgttt
gttcttctcatggaggataccgataccatcccggagagacatgctttcctgggtaactat
aggcgatacagttgttctattatcgaaagcatcatccagctgaggctcacggatgctttc
cagtacatcttgagccaggcagagaatgctttgcaaactctatacgagggacagccaccc
ctaaatccggcaacctacctcaaaaactccatgcccgttttgagagttgacgcccatgcc
acggtcattgaggcagccctcaaaggctacgtcaagtggagggcaagacaaggagaactc
cctggaggagaccaggaaatttcgagtatcgaaacacatctcgagcagtggtgtagtagg
ctgctggaaatgaatattgaggaccctctgatccgtaaacgtatcctccagctgcttgtc
gccttctccactacggctcttgacaccaaagccaacttcatgctgagggtgctcgagcat
atccttatgacatggcctgcattgcagcctgagcacaagaccttcaatgatgccatcagg
gatctccaaactgaaagcatggttgaattgcaaaggctcgcctccaagatgcctgatcat
ttactggacgtctacgaccaacttgaggttaaggtcaaggagatgatcgcctctggaact
ctcgatgagaagcgccagattgcgtatcgcagtttcctctttatcatcatccaccgagca
actcgcatagaccaagaaacgcggatcagacgtcttgctgagttcgtcgagccggtcaaa
aaccagtggaaggaagccccgttgcgacaatcactcagctcattcgagggattctgccag
ctcatcggtctagacaaggcgcaaaactacattgcacagcgccgtgttcaccaagttggt
gattggggtgcggtggaacttgatgccgaagggttggcgcttcaagctgaacttgaacag
agacaaacgttccttccgttacgttcaaccaagtcatttttgacctactctgtcgagaaa
ctggagaaaaattctcctgcttatcaagcatcctgcgccctctggcaggacgggttcccg
actattttaccagaactgctcaagtttttgagctacgcacatgcgtgccatgatccgaaa
aattggtctttgctcccagaagatatgcgtcctgttgtcagccgtctcctgaccgaccgc
ttttggcaagccggtatttcggaaggcagcaaagacgacttctatgcgcgagtcctagac
aagaagaacacgctagaagggcttgcctccaccattcgtggaactgtgcgctttgtccgc
gaggcatgctacgccgttatctactgcatgagccgacttgacgtgcagttttatgggttc
acggaacttcctgggcctttggcaaacgccttgttcgccgattcgttcagcctctcatct
catcagcttattaatctgctgaacttggtgaggtatctcgttgatcactgtcctgtggag
ctaagggatcatttcctacctcccatcctggccgcgtgcttccagcagatggatgccaag
atcagcagcgaatgggagaagctgggccaaaagcaaaccgtgcaggtggcagataatgag
gaactaacggaggagatgaaggcggaaagtatactcaggcaactgacatataccgcagcc
atcatggtggctgaattccttgacccggcaaggaccggaccacctagcaaccttccggcc
tctcccaacggcaccactccggaatctaggtatccatcacttcggagattctgtctcatg
caaacgtcaatcgctggccctctcctactattcctttgccacgcgattcacatgcgtgat
accaggtgctgtggcgtcgtcctgcgcgttttccgatccatcgtaccggagttccagatc
cagacgggtcagccgagagagcaaaaggaaccctctcatccagtgctacctgatgagaac
taccctattcccgatgctaccaaagcggaaattcaccagttcctctgcaccgacgtgatg
cgagccgcgatctcctcgatgaacgatccttatttcgttgacacccagaaggaccttgca
acactgatcgcaacaatcctttctcactattgcgtcggcgatgatttctcgggaggcaac
tccgcgccccgccaaatcctctgctcactgcccgggattaaggaacaggaagtggatagg
acgcttactttcctgcgacgccccgggacacattcgcgccaacagcgcgctgttgtgctc
gatttattgagaaatgtcaagagtgtgagcattagtgagatgggcaagctcaaggaccct
agagaagatcttgtcaagaaggctcctaagaggagcaagatggcccagaagttcatgacg
cctcagcagggcgccgatacttccgtgactggtactgaacagggaactggcaagaggcaa
gcgactcctgatctagaaggagtcgccggtatgttcgacgaaggtcactga

DBGET integrated database retrieval system