KEGG   Neurospora crassa: NCU02802
Entry
NCU02802          CDS       T01034                                 

Gene name
arg-13
Definition
(RefSeq) arginine-13
  KO
K15114  mitochondrial ornithine carrier protein
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncr02000]
    NCU02802 (arg-13)
Transporters [BR:ncr02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   NCU02802 (arg-13)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 3880622
NCBI-ProteinID: XP_964458
UniProt: Q01356
Position
I
AA seq 363 aa
MDSVPAQTHQGFKEAGAASASHLTTTTSLPTKVESRTAVMEALEDIVYGSAAGIVGKYIE
YPFDTVKVRLQSQPDHLPLRYTGPLDCFRQSIRADGFLGLYRGISAPLVGAALENSSLFF
FERIGRSLLYSSGFAPRDSELSLSALWFTGGFSGAFTSLILTPVELVKCKIQVPDEPGGA
GARQRQLKPIPVIKEIFRHEGLRGFWHGQLGTLIREAGGCAAWFGSKETTSKWFRGRNER
ALLKRGASQEEVVASRERPLPLWQQAIAGASAGMSYNFLFFPADTVKSRMQTSPIGGGGD
NGGKGAATMMPKKSFGEEARALWKQAGIKGFYRGCGITVLRSAPSSAFIFMVYDGLKKYF
PMA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggactccgtaccagcccagacgcaccagggcttcaaggaagcgggtgctgcttctgcc
tctcacctcacaacaaccacttctctaccgaccaaggttgagtcacggacagcagtgatg
gaggctctggaggatatcgtctacggatctgccgccggtatcgtaggcaaatacatcgaa
taccccttcgacacggtcaaagtccgcctgcaatcccaacccgaccaccttcccctgcgg
tacacgggacccctcgactgcttccgccaatccatccgcgccgacggcttcctcggtctg
taccgtggcatctcggccccgctcgtcggcgctgccctcgagaactcgtccctcttcttc
tttgagcgcatcggccgcagtcttttgtactcatccggcttcgccccgcgcgactcggag
ctctctttgtccgccctctggttcaccggcggcttttccggcgcttttaccagcctcatc
ctcacgcccgtggagctagtcaaatgcaagatccaagtccctgatgaacctggcggagca
ggagcacgacagcggcagctgaagccgatccccgtgatcaaggagatctttcggcatgaa
ggactacgtgggttctggcatgggcagctcggcacgctgattcgcgaagcgggcggttgc
gcggcctggttcgggtccaaggagaccacgtccaagtggttccgggggaggaacgagcgg
gcgctgctgaagcgcggtgcgagccaggaggaggtggtggcgagtagggaacggccgctg
ccgctgtggcagcaggcgattgcgggggcgtcggcgggcatgagctataatttcttgttt
ttcccggctgatacggtcaagagccggatgcagacgagcccgattggtggtggtggggat
aatggaggaaaaggagcagcgacgatgatgcccaagaagagttttggcgaggaggcgagg
gcgttgtggaagcaggcgggcatcaaggggttttatagggggtgcgggatcacggtgttg
aggagcgcgccgagctcggccttcatctttatggtgtatgatgggttgaagaagtatttt
cctatggcttga

DBGET integrated database retrieval system