KEGG   Neurospora crassa: NCU03268Help
Entry
NCU03268          CDS       T01034                                 

Definition
(RefSeq) hypothetical protein
  KO
K12590  exosome complex component RRP46
Organism
ncr  Neurospora crassa
Pathway
ncr03018  RNA degradation
Module
ncr_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NCU03268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncr03019]
    NCU03268
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     NCU03268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH
Motif
Other DBs
NCBI-GeneID: 3880570
NCBI-ProteinID: XP_964421
UniProt: Q7SEG0
Position
I
AA seq 251 aa AA seqDB search
MATVTPEASLNALPRADGSARYSYAGYTVTASVNGPIEAQRRDEHAYEAHVDVIVRPSAG
VGGTRERHLEFILQSSLSQIILVKNFPRSVIQIVLQVESTPENAYVNTKLVQASLNLPII
PALFQTAVLALLSAAVPMKATATSTVVAVVSDDGSKKIVADPSPQDIREATSLHVLAFTS
HDELLLSESEGDFTVKEWDGVYENAQKICCQTASKQDGIDMVLDDDASSPDMRHFLRSTL
ETKVASDLHWK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgtgacacctgaagcgtctctcaacgcccttccccgggcggatggatcggcc
agatactcatatgctgggtacacggtcacggcctctgtcaatggacccattgaggctcag
cgtcgggacgaacatgcttatgaggctcacgttgatgtaatcgtacgaccctctgccggg
gtaggaggaacacgagagcgccatctggaatttattttgcagtcttctctttctcaaatc
atccttgtcaagaactttccccgttctgtcatccaaatcgttcttcaagttgagagcacg
cctgaaaatgcttacgtcaacacaaaactggtccaggccagtttgaacctccccatcata
ccggccttgttccagactgccgttctcgctcttctatcggctgctgtgccaatgaaggca
accgctacatccacagtggtggcggtggtatccgacgacggttcgaagaagatcgtggct
gatccctccccccaggatatcagagaggcaacctcgctacatgtccttgcttttacctcg
cacgatgaactgcttctttcagaaagcgaaggtgacttcaccgtcaaggaatgggatggc
gtttacgaaaatgcccagaagatatgctgtcagactgcctcaaagcaggatggcatcgat
atggtgcttgacgatgacgcgtccagcccagatatgcgccatttccttcggtcgacgctg
gagaccaaagtagcatccgacctccactggaagtga

DBGET integrated database retrieval system