KEGG   Neurospora crassa: NCU03339
Entry
NCU03339          CDS       T01034                                 
Name
(RefSeq) glutathione reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
ncr  Neurospora crassa
Pathway
ncr00480  Glutathione metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU03339
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     NCU03339
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 Lys_Orn_oxgnase DAO FAD_oxidored HI0933_like Thi4 GIDA NAD_binding_8
Other DBs
NCBI-GeneID: 3872613
NCBI-ProteinID: XP_011393526
UniProt: Q873E8
Position
II:complement(1044478..1046785)
AA seq 503 aa
MPSLSFLVRPSVVSSRLASGRVGSLSRHFSVTALNMAPISRETDFLVIGGGSGGIATARA
AAGKYGIKSMVVEGKRLGGTCVNVGCVPKKVTFYAALVAETIHQAKDYGFSVEQTAPFDW
PTFKQKRDAYVARLNGIYERNLANDKVEYVHGWAKLLSPNSVEVTLDDGTKSVVNAKKIL
IAVGGNPTIPPHIPGSEYGTNSDGFFDIDTLPKKVALVGAGYIAVEFAGMLNALGVETHL
FIRHDTFLRSFDPMIQQVSVKEYERIGVKVHKKSQLTSVQKDAAGKLAINFKEGEGEQSI
SDVDHLIWAVGRTPAVEGLGLDKAGVKTNEKGYIEVDEYQNTSTENIYAVGDVCGQVELT
PVAIAAGRKLAARLFGPEEFRTLKLNYDNVPSVVFAHPEIGSIGLTEPEAVAKYGAENLK
IYKSSFTAMYYAMMKPEDKAPTAYKLICAGPEEKVVGLHIIGLGSGEILQGFGVAVNMGA
TKADFDNCVAIHPTSAEELVTLK
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgccctctctgtccttccttgtccgaccttctgttgtctcgtccagactagcttcaggc
cgagttggttcgttatctagacatttctccgtcacagctctcaacatggctcccatttcc
agagaaaccgacttccttgtcattggtggtggcagtggtggcatcgcgactgcccgcgct
gctgctggcaagtatggcatcaagtccatggtagtcgagggcaagcgtttgggaggtaca
tgcgtcaacgttggctgcgtgcccaaaaaggtcaccttctacgccgctcttgttgccgaa
accattcaccaggccaaggactacggcttcagcgtcgagcaaactgctcccttcgactgg
cctaccttcaagcaaaagcgcgacgcttatgtcgcccgtctcaacggcatctatgagcgc
aacctcgccaacgacaaggtcgagtatgtgcacggctgggccaagctcctgtcccccaac
tcggttgaggttactcttgatgacggtaccaagtcggtcgtcaacgccaagaagatcctg
atcgccgtgggcggcaacccgaccatccctccccatatccccggctcagaatacggcacc
aacagcgacggcttcttcgacatcgacaccctccccaagaaggttgcccttgttggcgcc
ggttatatcgctgtcgagtttgctggcatgttgaacgcccttggcgtggagactcatctc
ttcatccgccacgataccttccttcgtagcttcgatcctatgatccagcaggtgtcggtt
aaggagtatgagcgcatcggggtcaaggtccacaagaagagccaactcaccagtgtccag
aaggatgcggcgggcaagctggccatcaacttcaaagagggtgagggcgagcagtctatt
tccgacgttgaccatctcatctgggctgttggtcgcacgccggcggtcgagggtctcggc
ttggacaaggcgggtgtcaagaccaacgaaaagggctacattgaggtggacgagtaccag
aacaccagcaccgagaacatctacgccgttggtgatgtgtgcggtcaggttgagttgacc
cccgtcgccattgctgccggtcgcaagctggccgcccgtctgtttggccccgaggagttc
aggacactcaagctgaactatgataatgtgccatccgttgtgttcgcccatcctgaaatc
ggttccattggccttaccgagcccgaggcggttgccaagtacggcgccgagaacctcaaa
atctacaagtctagcttcactgccatgtactacgccatgatgaagcctgaggataaggca
ccgaccgcctacaagctcatttgcgccggccccgaggagaaggttgttggtctgcacatt
atcggccttggcagcggcgagatcctccagggcttcggtgtggccgtcaacatgggcgcg
accaaagccgacttcgacaactgcgtggctattcaccccaccagcgctgaggagttggtg
accctcaagtaa

DBGET integrated database retrieval system