KEGG   Neurospora crassa: NCU04077Help
Entry
NCU04077          CDS       T01034                                 

Gene name
cys-2
Definition
(RefSeq) cysteine-2
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
ncr  Neurospora crassa
Pathway
ncr00920  Sulfur metabolism
ncr01100  Metabolic pathways
Module
ncr_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NCU04077 (cys-2)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     NCU04077 (cys-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 POR NAD_binding_1 PFOR_II
Motif
Other DBs
NCBI-GeneID: 3873782
NCBI-ProteinID: XP_957692
UniProt: Q7RZE3
Position
Linkage Group VI; VI
AA seq 1030 aa AA seqDB search
MPSLSSISGPTYVNSQLLVQQTAYKLSDKIFSYSPETFDLDVAVKEWAEANEKNVHGETT
TVVPLQTRAGAGAFALGYIFSKDFDLAKRHVPQTLLAPSLSLRHLRSSLDQLALLYGVSS
PFVAHVAAADYSAEKGLGADYATALQIAEDLGLALVSSSSAYEVQHMSLLATLLASVLPT
LHIYDGIRTARESLRVVDALGEAHIADIYAKISKEAAALNKRLDTAGKVVELLKAFNNEL
GTSYAPFEYHGHEAPETVLVVFGSAEAQLAKQVASALAAEGKKVGTIVVRVYRPFVEEAF
LEVLPASVRQIAVLGQVADAAAVEDANVQSALYSDVLTAVSFTDKLSQAPEVVDVRYAVT
DAHTPSSIASIFNKLTSKGEAEPVAFSLTAVEEAQQYVFWDVDNSSAAASASAVGKLLET
EQSNNVYVHQTYDNLVQGGVVRTDIRVSQKSIEAPYPVESADVVFVGEEKLLKEIAIVKG
VKAGGKLIVRLPNFKEDELEKRIPAAAQKEIQEKGIELYVLDSSSSPALEKEAGLLVDVA
FLRVARADITKFDSLSADQTALTEAVNALDQSVRKVEVPAKWAEVENTVAPLVDSVKPNS
FVAFQKEEEEETSSLENWQSAAKGFAFKEAYGTQNQLRPDLTVKTYTIKVKENRRLTPTD
YDRNIFHIEFDLGDSGLTYNIGEALGIHADNDPEQVLQFIQAYGLNADDLVQVPSREDPA
VLETRTVYQSLVQNVDILGKPPKRFFEALAQFATDEEEKKKLERLGSKEGADEFKRLTEE
DTVTYVDVLDMFKSAHPDFNDLVRIVDPTKRREYSIASAQAVTPNSVTLMIVVVNWVDTK
GRTRYGHATRYLSGLAPGSTITASVKPSVMKLPVKDTAPLIMAGLGTGLAPFRAFVQYRA
MQKAQGKEIGSILLYLGSRHQREEYLYGEEWEAYLDAGVITLLGAAFSRDQPEKIYIQDR
MRQTVTDIVKAYIKEEGSFYLCGPTWPVPDVTAVLEEAIAAEAQESSRKVDPRKEIERLK
EDGRYVLEVY
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctctctcctccatctccgggccgacctatgtcaacagccagctgcttgtccag
cagactgcctacaagctctccgacaagatcttctcgtactctcccgagactttcgacctc
gatgtcgccgtgaaggaatgggctgaggccaacgagaagaacgtccacggcgagactacc
accgttgtccctctccagaccagggccggtgccggtgcttttgcccttggttacatcttt
tccaaggacttcgacttggccaagcgccatgtcccccagaccctcctggccccctcgttg
agccttcgtcacctccgctcttccctcgaccagctcgcccttctctacggcgtctccagc
ccctttgtcgcccatgttgccgctgccgactacagcgccgagaagggtcttggtgccgac
tacgctaccgctctccagatcgccgaggaccttggtctcgctctcgtctccagctcctct
gcctacgaggtccagcacatgtctctgctcgccactctcctggcgtctgtcctccccacc
ctccacatctacgacggtatccgcaccgcccgcgagtccctgcgggtcgtcgatgccctc
ggcgaggctcacattgccgatatctacgccaagatctccaaggaggctgctgccctgaac
aagaggctggataccgctggcaaggttgttgagcttctcaaggccttcaacaacgagctc
ggcacttcctacgctcctttcgagtaccacggtcacgaggcccccgagactgtccttgtc
gttttcggcagcgccgaggcccagctcgccaagcaggtcgcttccgctttggccgccgag
ggcaagaaggtcggcaccatcgttgtccgtgtctaccgtcccttcgtcgaggaggccttc
cttgaggttctccccgcctctgttcgccagattgctgttcttggccaggtcgccgatgct
gctgccgtcgaggatgccaacgtgcagtctgccctctactctgatgtcctcactgccgtc
tccttcaccgacaagctgtctcaggcccccgaggttgttgatgtccgttatgcggttacc
gatgcccacacccccagctccatcgcctccatcttcaacaagctcaccagcaagggcgag
gccgagcccgtcgcttttagcctgaccgctgtcgaggaggcccagcagtacgttttctgg
gatgttgacaactcctctgccgctgcttctgcttcggccgttggcaagctcctcgagacc
gagcagtccaacaacgtctatgttcaccagacctacgacaaccttgtccagggtggtgtt
gtccgcaccgacattcgcgtgtcccaaaagtccatcgaggccccttaccctgttgagagc
gctgacgtcgtcttcgttggtgaggagaagcttctcaaggagattgccatcgtcaagggt
gtcaaggccggcggcaagctcattgttcgtcttcccaacttcaaggaggacgagcttgag
aagcgcatccctgctgctgctcaaaaggagattcaggagaagggcatcgagctctacgtc
ctcgactcctcttcttctcctgctcttgaaaaggaggccggcctccttgttgacgttgcc
ttcctccgcgttgctcgtgctgatatcacaaagttcgactcgctctccgctgaccagacc
gctctgaccgaggccgtcaacgcccttgatcagtccgttcgcaaggttgaggtgcccgcc
aagtgggccgaggtcgagaacactgttgctcctcttgttgacagcgtcaagcccaacagc
ttcgtcgccttccagaaggaggaggaagaggagacctccagcctcgagaactggcagtct
gccgccaagggcttcgctttcaaggaggcctacggcacccagaaccagctccgccctgac
cttaccgtcaagacctacaccatcaaggtcaaggagaaccgccgtctcacccccaccgac
tatgaccgcaacatcttccacattgagtttgatctcggtgactctggtctcacttacaac
attggcgaggctcttggtatccacgccgacaacgaccctgagcaagtcctccagttcatc
caggcttatggcctcaacgcggatgaccttgtccaggttccttcccgcgaggatcccgcc
gtgctggagacgcggactgtctaccagtccctcgtccaaaacgtcgacattcttggcaag
cctcccaagcgcttcttcgaggccctcgcccagttcgccaccgacgaggaggagaagaag
aagctcgagcgtcttggcagcaaggagggcgccgacgagttcaagcgtcttactgaggag
gatactgtcacttatgttgatgtgcttgacatgttcaagtcggcccaccccgacttcaac
gacctcgtccgcatcgtcgaccccaccaagcgcagagagtactctatcgcctctgcccag
gctgtcacccccaactcggtcactctcatgatcgtcgttgtcaactgggtcgataccaag
ggccgcacccgctacggccatgccacccgctacctctcgggccttgctcccggcagcacc
atcaccgcctcggtcaagccttcggtcatgaagctccccgtcaaggacacggcccctctc
atcatggctggtctcggtaccggtctcgctcccttccgcgcgttcgtccagtaccgcgcc
atgcagaaggcccagggcaaggagatcggctccatcctcctctacctcggttcccgtcac
cagcgcgaggagtacctctacggcgaggagtgggaggcttacctcgacgccggcgtcatc
accctgctcggtgccgccttctcgcgtgaccagcccgagaagatctacatccaggatcgc
atgcgccagaccgtcaccgacattgtcaaggcctacatcaaggaggagggctccttctac
ctctgcggtcccacctggcctgtgcctgatgtcactgccgtgcttgaggaggccattgcg
gctgaggctcaggagagcagccgcaaggtcgacccccgcaaggagattgagaggctcaag
gaggatggccgctatgtccttgaggtgtactag

DBGET integrated database retrieval system