KEGG   Neurospora crassa: NCU04130Help
Entry
NCU04130          CDS       T01034                                 

Definition
(RefSeq) acylase ACY 1
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
ncr  Neurospora crassa
Pathway
ncr00430  Taurine and hypotaurine metabolism
ncr00460  Cyanoamino acid metabolism
ncr00480  Glutathione metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NCU04130
   00460 Cyanoamino acid metabolism
    NCU04130
   00480 Glutathione metabolism
    NCU04130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncr01002]
    NCU04130
Enzymes [BR:ncr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NCU04130
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NCU04130
Peptidases and inhibitors [BR:ncr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NCU04130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 3877450
NCBI-ProteinID: XP_961286
UniProt: Q1K7M2
Position
Linkage Group V; V
AA seq 603 aa AA seqDB search
MPLPTSSIYQPPSAEFMKWPSRRSVVHSTKGIVACTQPLAAKCGIDILNAGGNAADAAVA
VAAGLNMTEPCSTGIGGDMFCLYYDASTGKVSALNGSGRAGGKCTLENVRKSLKIPEGTV
GKIPMSSVHAVTVPGAAAGWVDTVERFGSGKLTMGQILAPAIELGEKGFPVSETTAYFWG
RQEKGIREASPNFAEMLKADSSAPDGVRAPKAGEIIKLPNLAKTFRTLATEGKKGFYSGR
IAEELIKVVNDLGGHLELADLQHHLETGSESVEPISLKFPNPHGTSETDGVELWEHPPNG
QGIVALMVLGILKHLIKQGTIPAFGPSDHNTAPYLHAIVEALRISFGDASWFVTDPNAAP
GVPTSQLISASYLAERAKLFSPSSANTSVLQPGDPYASPALTSSDTVYFACSDSQGNAIS
FINSNYGGFGTCIIPAGCGFTLQNRGANFSLDAKHPNVLAPRKRPYHTIIPGLVTNLQDS
SLHSVFGVMGGFMQPQGHVQTLLGQVLCGLSPQQALDAPRVCIGAGMPDEGNVYDATVHV
EEGMPEETVDGLRKLGHKVEVVKGMGRILFGRGQIIRWTKDIDGTGVWSAGSDMRGDGAA
YPA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccccacctcatccatctaccaacctccatcggctgagttcatgaaatggccg
agtcgaagaagcgtggttcatagcaccaaaggaattgtggcttgcacacaaccgcttgcc
gccaagtgcggtatcgacatcctcaatgcaggaggaaatgctgccgatgccgccgtggcc
gttgctgccggcctgaacatgacggaaccttgctcaaccggcatcggcggtgacatgttt
tgcctctactacgatgcttcgactggcaaggtctcggccctgaacggctctggacgcgcg
ggcggcaagtgtaccctcgagaacgtccgaaagagcctaaaaattccagagggcaccgtg
gggaagatccccatgagcagcgttcacgctgtgacggtgcctggtgctgccgccggttgg
gtcgatactgtcgagcggttcggtagtggcaagttgaccatggggcagattctcgcaccg
gcgattgagctgggtgagaagggatttcctgtatcggagacgacggcttatttctgggga
agacaggaaaagggcatccgcgaagcgtctcccaacttcgcggagatgttaaaggccgat
tcctctgctcctgacggtgtccgcgctcccaaggccggcgaaatcatcaagctacccaac
ctcgccaagaccttccgcaccctggcaaccgaaggcaagaagggtttctacagcggtcgc
attgccgaagaacttatcaaagtcgtcaacgacctcggaggccatcttgagcttgccgac
ctccaacatcacctcgaaaccggcagcgaatccgtcgagcccatctccctgaaatttccc
aacccccacggcacctccgaaaccgacggcgtcgagctttgggaacaccctcccaacggc
caaggcatcgttgccctgatggtcctcggcatcctcaagcacctcatcaagcaaggcacc
atcccagccttcggcccctccgaccacaacacggccccctacctgcacgccatcgtcgaa
gccctccgcatctccttcggcgacgcctcctggttcgtcaccgaccccaacgccgctccc
ggcgtcccgacctcccagctcatctcggcctcctacctcgccgagcgcgccaagctcttc
tctccatcctccgccaacacctcggtcctgcaaccgggcgacccgtacgcctctcccgcc
ctgacctcctccgacaccgtatactttgcctgctctgactcccaaggcaacgccatctcg
ttcatcaactccaactacggcggcttcggcacctgcatcatccccgccggctgcggtttc
acgcttcagaatcgcggcgccaacttctcgctggatgcgaagcacccgaatgtgctagcg
ccgagaaagaggccttaccacacgattattcccggtctggtcacgaatctgcaggatagc
agtctgcactcggtgtttggcgtcatgggcggattcatgcagccgcaggggcatgtgcag
acgttgcttgggcaggtgttgtgcgggctgagcccgcagcaggcgttggatgcgccgaga
gtgtgtatcggcgcgggaatgccagatgaggggaatgtgtatgatgcgacggtacatgtg
gaagaggggatgccggaggagacggtagatggattaaggaagttggggcataaggtggag
gttgtgaagggtatggggagaatcttgttcggcaggggacaaattattcgatggacgaag
gatattgatggcacgggggtgtggtcggcgggaagcgatatgagaggcgatggtgctgct
tacccggcgtaa

DBGET integrated database retrieval system