KEGG   Neurospora crassa: NCU04230Help
Entry
NCU04230          CDS       T01034                                 

Gene name
acu-3
Definition
(RefSeq) acetate utilization-3
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00630  Glyoxylate and dicarboxylate metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01200  Carbon metabolism
Module
ncr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCU04230 (acu-3)
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCU04230 (acu-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 3877001
NCBI-ProteinID: XP_960854
UniProt: P28299
Position
Linkage Group V; V
AA seq 548 aa AA seqDB search
MAANNMVNPAVDPALEDELFAKEVEEVKKWWSDSRWRQTKRPFTAEQIVSKRGNLKIEYA
SNAQAKKLWKILEDRFAKRDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASSSDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKDQREKLANIDYLRPIVADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRAQA
DIMGSDLLCIARTDAEAATLITTTIDPRDHAFILGCTNPDLEPLADLMMKAEAEGKTGAQ
LQAIEDDWLAKADLKRFDEAVLDVIAKGKFSNAKDLAAKYQAAVKGKQISNREARAIARQ
LLGQEIFFDWESPRTREGYYRLKGGCDCSINRAISYAPYCDAIWMESKLPDYAQAEEFAK
GVHAVWPEQKLAYNLSPSFNWKTAMGRDDQETYIRRLAKLGYCWQFITLAGLHTTALISD
QFAKAYSKIGMRAYGELVQEPEIDNGVDVVKHQKWSGATYVDELQKMVTGGVSSTAAMGK
GVTEDQFH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaacatggtcaaccccgccgtggatcccgctctcgaggacgagcttttc
gccaaggaggtcgaggaggtcaagaagtggtggagcgactcacgctggaggcaaaccaag
cgccctttcaccgctgagcagatcgtctccaagcgtggaaacctcaagatcgagtacgcc
agcaatgcgcaggccaagaagctttggaagatcctcgaggaccgcttcgctaagcgcgat
gcctcttacacatacggctgcttggagcctaccatggtgacccagatggccaagtacctc
gataccgtctacgtttccggctggcaatcatcctcgaccgcctcctcttctgacgagccc
ggcccggatcttgctgattacccctacaccaccgtccccaacaaggttggccacctcttc
atggcccagctcttccacgaccgcaagcagcgccaggagcgcctctccgtccccaaggac
cagcgcgagaagctcgccaacatcgactacctccgccccatcgttgccgatgctgacacc
ggtcacggtggtctgaccgccgtcatgaagctcaccaagctcttcattgagaagggtgct
gccggtattcacattgaggaccaggcccctggtaccaagaagtgcggccacatggccggc
aaggtcctcgttcccatccaggagcacatcaaccgtctcgtcgccatccgtgcccaggct
gatatcatgggctccgacctcctctgcattgcccgtaccgatgccgaggccgccaccctc
atcaccaccaccatcgacccccgcgaccacgcttttatcctcggctgcaccaaccccgac
ctcgagcccctcgccgacctcatgatgaaggctgaagccgagggcaagaccggtgcccag
ctccaggccattgaggacgactggctcgccaaggccgaccttaagcgctttgacgaggcc
gtccttgatgtcatcgccaagggcaagttttcaaacgccaaggacctcgctgccaagtac
caagccgccgtcaagggcaagcagatctccaaccgcgaggcgcgcgccattgcccgccag
ctgctcggccaggagatcttctttgactgggagtccccccgtacgcgcgagggctactac
cgcctcaagggcggctgcgactgctccatcaaccgcgccatctcctacgctccctactgc
gacgccatctggatggagtccaagcttcccgactacgctcaggccgaggagttcgccaag
ggcgtccacgccgtctggcccgagcagaagctcgcctacaacctttctccctccttcaac
tggaagaccgccatgggccgcgacgaccaagagacgtacatccgccgcctcgccaagctc
ggctactgctggcagttcatcaccctcgcgggcctgcacaccacggcgctcatcagcgac
cagttcgccaaggcgtacagcaagatcggcatgcgcgcctacggcgagctcgtccaggag
cccgaaattgacaacggcgtcgatgtcgtcaagcaccagaagtggtcgggcgccacgtac
gtggatgagctgcagaagatggtcaccggtggtgtcagctcgacggcggcgatgggcaag
ggtgtcactgaggatcagttccactag

DBGET integrated database retrieval system