KEGG   Neurospora crassa: NCU04720
Entry
NCU04720          CDS       T01034                                 

Gene name
nit-6
Definition
(RefSeq) nitrate nonutilizer-6
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ncr  Neurospora crassa
Pathway
ncr00910  Nitrogen metabolism
ncr01100  Metabolic pathways
Module
ncr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ncr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NCU04720 (nit-6)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     NCU04720 (nit-6)
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C NAD_binding_9 NAD_binding_8
Other DBs
NCBI-GeneID: 3876518
NCBI-ProteinID: XP_960355
UniProt: P38681
Position
Linkage Group VI; VI
AA seq 1176 aa
MANTSLDMASSTSPSPSPESTTTPRKRIVVVGLGMVGIAFIEKLIKLDTQRQYEIVVIGE
EPHVAYNRVGLTSFFSHREVEQLYLNPLEWYKQHLQTSSLTHHLSTAALSLSPATKSLTI
SPPPSTPSLTTLPYDHLILATGSSALLPTSTPGHDASGVFVYRNIADLQSLITWSSDTQI
KGSTGVVVGGGLLGLEAAKALMDLQVFGRVVVIERNGWVLSRQVDGEAGALVLEGVRGLG
VEVLTRKRVKEVECDESKDEGEKEKKRVKGIRFEDGEYLACSTICFAIGIKARDELAREA
GITCAERGGGGIVVDDSLQTSAPDVYAIGECASWKGQTFGLIGPGVEMADVLAFNFTQAH
LHTPRVFKRPDLSTKLKLLGVEVASFGDFFADRDGPKELPPKLRRELKKSGGKAEVKALT
YKDPFLSVYKKYIFTSDGKYLLGGMMIGDTTDYVRLVPLVKTHKELDVPPSQLILGAKKS
GDDNGDDDLPDDTQICSCHNVTKADLVAPLKSGECTSLGDLKSCTKAGTGCGGCMPLVTS
IFNRTMASLGTEVKNNLCPHFPEYSRADLYNIISVKRLRTLPDVMREAGADADSLGCEAC
KPAIASIFASLWNDHVMSPAHHGLQDTNDRFMGNIQRNGTFSVVPRVAAGEITPEKLIVI
GEVAKEYNLYTKITGGQRIDMFGAKKQDLLKIWKKLVDAGMESGHAYAKSLRTVKSCVGT
TWCRYGVGDSVGMAVRLEERYKGLRGPHKIKGGVSGCTRECAEAGNKDFGLIATEKGFNI
LICGNGGTTPKHSVLLAKDVPPTNVIPIIDRFLMFYIRTADKLQRTARWLEALPGGIDYL
KEVILEDRLGICASLEAQMQELVDSYFDEWAEALNNPAMQERFKQFANTDEGQPPMEVEI
DRGQERPVMWPREDEGGSAKADFKGLRDKWSSTTWQPVLEASYFQGADDLPNGISASIKR
GDTQLAVWRIKGKYYASQQMCPHKRTFALSDGFVGTDPSPSSCSSSALPPSPPSTPPRSS
SPVTSPPQSPTSSATPATTASSSCTTNPSGPASPWISCPFHKRNFSLTSGSCKNDNELSI
ATFDVEERDDGMVYIKLPPVDELDRELGTKKWMVKKGEAGEGQLRELDELNKSKGVEGKK
GRRGRKPGASEAGKEVGKKLVEAVGGGGCGGPGLEW
NT seq 3531 nt   +upstreamnt  +downstreamnt
atggcaaacacatcattggatatggcttcaagtacaagcccaagcccaagtccagaatca
actacaactccccgaaagaggattgttgtcgtggggttgggcatggttggtattgctttt
atcgaaaaactcatcaaactcgacacccagcgccaatacgaaatcgtcgtcatcggcgaa
gaaccacatgtagcctacaaccgcgtcggcttgacgtcgttctttagtcatcgcgaagtt
gagcagttgtatcttaatcctctggaatggtacaaacaacacctccaaacctcctcccta
acgcaccacctctccaccgctgccctctccctctcccccgccaccaaatccctcaccatc
tccccacccccctccactccttctctcaccaccctcccctacgaccacctcatcctcgcc
accggctctagcgccctcctgcccacctctacaccaggccacgatgcgtccggcgttttc
gtctacaggaatatcgccgacttgcagtccctcatcacatggtcatccgacactcaaata
aagggatcaacaggcgtggtagtcggcgggggactactaggactagaagcagccaaagcc
ctaatggacctgcaagtattcggacgtgtggtggtgatcgaaagaaacgggtgggttttg
tctcggcaagtagacggggaagccggggctttggtgttggagggggtaagggggttgggg
gttgaagttctcacgagaaagagggtcaaggaagttgagtgtgatgaatcgaaagacgag
ggagagaaagagaagaaaagagtaaaggggatacgcttcgaagacggggaatacctggct
tgttcgaccatttgtttcgcgatcgggatcaaagccagggacgagctggcgcgcgaagcg
gggattacgtgcgcagagcgcgggggaggaggcatagtggtggatgattccctccagacc
agcgcgccggacgtttatgccattggcgagtgtgccagctggaaaggccagacgttcggg
ctgattgggcccggcgtggagatggcggacgtgttggcgtttaactttacgcaagcgcat
ttacatacgccgcgcgtgttcaagcggccggacctcagcaccaagctcaagttgctgggt
gtggaagtggctagtttcggcgacttctttgccgaccgcgatggaccgaaggagttaccg
cccaaactgaggagggagctcaagaagagcggcgggaaggcggaggtaaaggcactcacc
tacaaagaccccttcctctccgtctacaaaaagtacatcttcacttcggatgggaagtac
ttgctaggaggaatgatgattggcgacacaaccgactacgtccgtctcgttccgctcgtc
aagacccacaaggagctggacgtccctccatcgcaactcatcctcggcgccaaaaagtcc
ggtgacgacaacggagacgacgacctccccgacgacacgcaaatctgctcctgccacaac
gtcaccaaagccgacctcgtcgcccctctcaagtccggggaatgcacctccctaggcgac
ctcaagtcatgcaccaaagccggcacggggtgcggcgggtgcatgccgctggtgacgtcc
atcttcaaccgcaccatggcgtcgctggggactgaagtcaagaataacctctgcccgcac
ttcccggagtactcgcgcgcggacttgtacaacatcatctccgtcaagcgactgcgtacc
ctgccggacgtgatgcgcgaagccggcgcggatgcggatagcttggggtgcgaagcgtgc
aagccagccattgcttccatttttgcgtcgctgtggaatgatcatgtgatgagtcctgct
catcatggcctgcaggatacgaatgatcggttcatggggaacatccagcgcaacggaacc
ttttcggtcgttcctcgcgttgcggcgggagagattacgccggagaagttgattgtcatt
ggagaggtggccaaggagtataacctctacaccaaaatcactggcgggcagaggatcgat
atgtttggcgcgaaaaagcaggatttgttgaagatctggaagaaattggtggatgcaggc
atggagagcgggcatgcgtacgcgaagagcttgcggacggtcaagagctgtgtcgggaca
acgtggtgtaggtatggagtgggtgatagcgtggggatggcggtcaggttggaggagagg
tataaggggttgagggggccgcacaagattaagggaggagtgtctgggtgtacgagagag
tgcgcggaggcggggaacaaggatttcggcctcatagccaccgaaaagggtttcaacatc
cttatctgcggcaacggcggcaccacgcccaagcactccgttcttctcgccaaagacgtc
cccccgaccaacgtcatccccatcattgaccggttcctcatgttctacatccgcaccgcc
gacaagctccaacgcactgcgcgctggctcgaagcccttcccggtggcatcgactacctg
aaggaagtcatcctcgaagaccgcctcggtatctgcgcctcactagaagcccagatgcaa
gagctggtagacagttactttgacgagtgggccgaagctctcaacaaccccgcgatgcag
gagcggttcaagcagttcgccaacaccgacgagggccaaccacccatggaagtcgaaatc
gaccgcgggcaagaaagacccgtgatgtggccccgcgaggacgaaggcggttcagccaag
gcggacttcaagggcttgcgagacaagtggtcatcaaccacctggcaacccgttctcgaa
gcatcctacttccagggagcagacgaccttcccaacgggatatccgccagcatcaagcgc
ggcgacacgcaactggccgtctggcgcatcaaagggaagtactacgcttctcagcagatg
tgtcctcacaagcgcacctttgctttgtctgacggttttgttggcaccgatccgtcgcca
tcttcttgttcttctagcgccctgccgccatcaccacctagtactcctcctcggtcttca
tcccctgtgacatctccacctcagtctcccacctcttctgccacaccggcaaccacagcc
tcctcctcttgcaccaccaacccttccggccctgccagcccttggatctcctgccccttc
cacaagcgaaacttctcgctcacgtcggggtcatgcaagaacgacaacgagctctccatt
gccacatttgatgtggaagaaagagacgacggtatggtgtatatcaagctgccgcctgtt
gacgagttggacagggaattggggacgaagaagtggatggtcaagaagggagaggcgggt
gaaggccaacttagagagttggacgagttgaataagagtaaaggggtagaggggaagaag
gggaggagggggaggaagccgggtgctagcgaggctgggaaggaggttggtaagaagttg
gttgaggcggttgggggagggggctgtggtgggcctgggttggagtggtga

DBGET integrated database retrieval system