KEGG   Neurospora crassa: NCU05623Help
Entry
NCU05623          CDS       T01034                                 

Gene name
tim17
Definition
(RefSeq) translocase of mitochondrial inner membrane 17
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
ncr  Neurospora crassa
Brite
Mitochondrial biogenesis [BR:ncr03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    NCU05623 (tim17)
Transporters [BR:ncr02000]
 Other Transporters
  Others
   NCU05623 (tim17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 3876316
NCBI-ProteinID: XP_960167
UniProt: P59670
Position
Linkage Group VI; VI
AA seq 155 aa AA seqDB search
MDHTRDPCPWVILNDFGGAFAMGAIGGTIWHGIKGFRNSPYGERRIGAITAIKMRAPALG
GNFGVWGGLFSTFDCAIKGLRNHKEDPWNSILAGFFTGGALAVRGGYKAARNGAIGCAVL
LAVIEGVGIGFQKMLAGATKLEAPAPPPSNEKVLA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggatcacactcgcgacccttgcccgtgggttatcctcaacgatttcggtggtgccttc
gccatgggtgctatcggtggtacgatctggcacggtatcaagggcttccgtaacagccct
tacggcgagaggagaatcggcgccatcactgccatcaagatgcgcgcccctgcgctcggc
ggtaacttcggtgtctggggtggtcttttcagcacattcgactgcgctatcaagggacta
aggaaccacaaggaggacccgtggaactccatcctcgccggtttcttcacgggtggcgcg
ttggcggttcgtggtggctacaaggcggcccgtaacggtgctatcggctgcgctgtcctc
ctggctgttattgagggtgtcggtattggtttccagaagatgcttgcgggcgccacaaag
ctagaggctcctgcgccacctccgtccaacgaaaaagttcttgcctaa

DBGET integrated database retrieval system