KEGG   Neurospora crassa: NCU05902Help
Entry
NCU05902          CDS       T01034                                 

Definition
(RefSeq) vacuolar assembly protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ncr  Neurospora crassa
Pathway
ncr04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    NCU05902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncr04131]
    NCU05902
Membrane trafficking [BR:ncr04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    NCU05902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin SDA1 Vps39_1 RXT2_N BUD22 zf-RING_11 NOA36 TPR_7 zf-RING_5 zf-RING_2 Pox_Ag35 Nop14
Motif
Other DBs
NCBI-GeneID: 3875607
NCBI-ProteinID: XP_959460
UniProt: Q7S403
Position
Linkage Group VII; VII
AA seq 1359 aa AA seqDB search
MTQVPPETGDSADTTPAPTIVTSPRARPKRSIGSSTIGTTTTSTATATGTGTDGESGISV
EEGLEVNGGRADGEGEETEDDDEDEDEDDDEDDDEEEEEEEEDEEPKLKYARLTEHLGPL
YRNGDATSAFLTAGDKMIVGTHNGNIHVLQLPAFQSLRVYHAHSASVTSLSISPYPPPLP
TFDPKPLTRVFSQTNSPLRPASASTESHHQTNPASAARKRDAQAHGVPNTPSNNIHIATS
SMDGNVCVQSLIDVKDVTLRNFARPVQAVALSPDYKNDRTYLSGGLAGQLILTVGAPQGK
STATTTGAAAQAAGWLGNMVGAGSGKDTVLHSGEGTINTIKWSGSGKYVVWLNEHGIKIM
RTKLHLESADQEDAWKRIGHIDRPQTEEWDTMASVWKGRAEWIDEQSIEPDEPGKGQKEV
PASPAAAILKQQHQKTEKKVERLLVGWGGTIWFIHVHPGGMGVGKHAGERSAGRAEIVKL
LRMDCIISGISLYTQNLLLVLAYCLPDENEDEEDDNVIPSHKHAASIASRASHPSGGIKR
RQNNPPPELRLIDLTSQAEIDKDGLSVSRFERLTASDYHLGVLPARNVAASAASKGTLET
LAGFGTDMLNVGLTGLNVALNPKSLFSSGASIKSRDSDETPSNYMGGINSALKGGHRTAI
HQNLNKPGIKIFIHSPYDCILATKRDLADHLGWLLERQQYRQAWELVDEHPEIVSATDRA
SELGGSETPDRAQNDDFDDETSSVIDGLRSHYSLAEKEKRRIGELWIHELVEANDWAQAG
QICGKVLGTPDRWEKWVWTFAGANKFDDIVNYIPTERTRPPIPGTIYEVVLGHYLQVSKP
RFRELLERWSSDLFDVATITTALENQLKYRDVREDSVEDGEVGRDWRIVMESLAKLHEAS
GRTKEALRCYIRLQDADSAMRLIKDAHLAEAVADDIPSFIGLRVPQDKLLKMSKEDLEQA
TSEAISLLVDEAQHGLVKPDLVVSQLQEKDLKLYTFFYLRGLWRGEGIHEHTHESLARLV
LDSRTMVDQFADLAVHLFAIYDQPLLNQFLRTSTAYAFEKAAQECESRNYIPELVYLYSK
TGQVKRALYLIIERLGDVSRAIAFAKEQDDPDLWEDLLEYSMDKPKFIRALLEEVGTAIN
PITLVRRIPEGLQIPGLREGIRHIMKEHEIQYSISEGVSRVLRSEVAAAMNTLRNGQRKG
VKFQVGVREGGEHVDVQPTDIPTQPLTEKPSSSGLASPAAPSQQPPPTPSTPTHRRPKSA
AKKYQAGHCAQCLSPFTTYETDTLVGFACGHVFHLPHLLEALNPGKTVDADVLLGGMGAE
ERSAHLVGAKVTHARLLRDRIVGGCVVCKAAKEEEGEGR
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggtcccgcctgagacaggcgactctgccgacaccacgcccgctcccaccatc
gtgacgtctcccagggcgcggcccaagcgatccattggcagcagcaccattggcaccacc
accacctcgacggcgacggcgacaggaacgggcacagatggagaatccggcatctcggta
gaggaagggttggaggtcaacgggggccgtgcagatggggagggagaagaaaccgaggat
gacgatgaggacgaggacgaggacgacgacgaggacgacgacgaggaggaagaagaggag
gaggaagacgaggaaccaaaactcaaatacgcccggctcactgaacacctcgggcctctg
tatcgcaatggcgacgccacaagcgccttcttgacggctggcgacaagatgatcgttgga
acgcataacggcaacatccacgtcctccaactgcccgccttccagtccctgcgcgtctac
catgcccacagcgcctccgtcaccagcctctccatctcgccctacccaccccctctccca
accttcgacccaaaacctctcacccgagtcttttcccaaacaaacagccccctgcggcct
gctagcgcatccaccgaaagccaccaccagaccaacccggcctccgccgcacgcaaacga
gacgcccaggcccatggagtccccaacaccccctccaacaacatccacatcgcgacctcc
tctatggatggtaacgtctgcgtccagtctctgatcgacgtcaaggatgttactctccgc
aactttgcccgacccgtacaagctgttgctctctctcccgattacaagaacgacaggacc
tatctgtctggcggtctggctggtcagctcatcctgaccgtcggcgccccacagggcaag
agcacggccactacgacaggagccgctgctcaggcggcaggatggctcgggaacatggtg
ggcgcagggtccggcaaggataccgttctacactcgggtgagggcaccatcaacaccatc
aagtggtccggatccgggaaatatgtcgtctggctgaatgagcacggcatcaagattatg
aggacgaagctccatctcgaaagcgccgatcaagaagatgcatggaaacgaattggtcat
attgatcgcccgcagacagaggagtgggataccatggccagcgtctggaaaggtcgtgcc
gagtggattgacgagcagtccatcgagcctgatgagccgggcaagggtcagaaggaggtg
ccggcttctcctgcggctgcgatcctgaagcagcaacaccagaagaccgagaagaaggtg
gagagattgctggtgggatggggaggcaccatatggttcattcacgtccaccctggcggc
atgggcgtcggcaaacacgcgggagaaaggtccgctggacgggcagagattgtaaagcta
cttcgcatggactgcatcatttccggcatctcgctatatacccaaaacttgttattagtg
ctcgcatactgcttaccagacgaaaacgaggacgaagaagatgacaatgtcattccaagt
cataaacacgccgcatcaatagcatctagagcaagccacccatccggcgggatcaagcgc
agacaaaacaacccgccaccagaactgcgcctgatcgatctcacatcacaggccgagatt
gacaaggacgggttgagcgtcagccgattcgaacgcttgactgccagcgattaccacctc
ggagttctgccggctcgcaatgtagccgcctctgcagccagcaaaggcaccttggagact
ttggctggcttcggtaccgacatgctcaacgtcggcctgaccggcctcaacgtggcgctg
aatcccaagtctctcttcagctcaggcgccagcatcaagagcagagacagcgacgagacg
ccttcgaactacatgggagggattaactcggcattgaagggcggacatcgcacagctatc
catcaaaacctcaacaaacccggcatcaagatcttcatccacagcccgtacgactgtatc
ctggcaacaaagagagacttggccgaccaccttggatggttgctggaacgccagcagtac
agacaagcatgggagctggttgacgagcatccggagattgtgtctgcgaccgaccgggcg
tccgagctgggcggctccgaaactcccgaccgagcccaaaacgatgactttgacgatgag
acctcctctgtcatcgacggcctgcgcagccactattctcttgctgaaaaggaaaaacga
cgcataggcgaactctggatccacgaactagtcgaagccaatgactgggcccaagccggc
cagatctgcggcaaagtcctcggcacccctgaccgctgggagaaatgggtctggaccttt
gccggcgccaacaagtttgatgacattgtcaactacatccccaccgagcgaacacgaccg
cccatccccggaaccatctacgaagtcgtgctgggccattacctccaggtcagcaagccc
cggttcagagagctgctggaacgatggtcgtcggatttgtttgacgttgccaccataacc
acggctctggagaaccagctcaagtaccgtgatgtccgagaggacagcgtcgaggatggc
gaggtaggaagagattggcgcatcgtcatggagagtctggccaagttacacgaggctagc
gggcggaccaaggaggcgctccgatgttacatcaggttacaggatgcggactcggcgatg
cgactgattaaagatgcgcatctggccgaggcggtggcggacgatattcccagcttcatc
ggccttcgcgtgccgcaggacaagctcctcaagatgtccaaggaagatcttgagcaggct
actagtgaggccatctcgctgttggtcgacgaggcgcagcatggcttggtgaagccggac
cttgtggtgtcgcagttacaggagaaggacctgaagctctacacattcttctacttgcga
ggtctctggcgtggtgaaggcatccacgaacacacgcacgagtctctagcccgtctggtc
ctcgacagccgcaccatggtagaccaatttgctgatctggctgtccacctctttgccatt
tacgaccagccactgctcaaccagttcttgaggacatcgacagcatatgcctttgagaag
gctgcccaagaatgcgaaagccgcaactacatccccgagctcgtctacctctactccaag
accggccaggtgaaacgagcgctctacctcatcatcgagcgcctcggcgacgtctcccgt
gctattgcctttgccaaggaacaagacgaccccgatctctgggaagatctgctcgagtac
tctatggacaaacccaagttcatccgcgccctgcttgaggaagtggggacggctatcaac
cccatcacacttgtgaggagaatacctgaggggctacagattcctggcctgagagaaggt
ataaggcatatcatgaaggagcatgagatccaatactctatctcggagggcgtcagccgc
gtgttgagaagcgaagttgcagcggctatgaacacactgcgaaacggccagcgcaagggc
gtcaaattccaagttggcgtcagggaaggaggcgaacacgtggacgtccagcctacggat
atcccgacgcaacccttgaccgagaaaccttcctcctccggccttgcctccccagccgct
ccatcgcagcagccaccaccaaccccgtcaacaccaacccaccgccgccccaaatctgct
gcgaagaagtaccaagccggccactgcgcccagtgcctctccccctttaccacgtacgaa
acagacacgctggtcggcttcgcttgcggacacgtgtttcacttgccgcatttactagaa
gcgttgaatccggggaagacggtcgatgccgatgtgttgttgggaggtatgggagcagag
gaaaggagcgctcatttggttggggcgaaggtgacgcatgcgagattgttgagggatcgg
atcgttggcggttgtgttgtttgcaaggctgctaaggaggaggaaggggagggaagataa

DBGET integrated database retrieval system