KEGG   Neurospora crassa: NCU06026
Entry
NCU06026          CDS       T01034                                 

Symbol
qa-Y
Name
(RefSeq) quinate-Y
Organism
ncr  Neurospora crassa
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 3875775
NCBI-ProteinID: XP_959616
UniProt: P11636
Position
Linkage Group VII; VII
AA seq 537 aa
MTLLALKEDRPTPKAVYNWRVYTCAAIASFASCMIGYDSAFIGTTLALPSFTKEFDFASY
TPGALALLQSNIVSVYQAGAFFGCLFAYATSYFLGRRKSLIAFSVVFIIGAAIMLAADGQ
GRGIDPIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLVGIYELGWQIGGLVGFWIN
YGVNTTMAPTRSQWLIPFAVQLIPAGLLFLGSFWIPESPRWLYANGKREEAMKVLCWIRN
LEPTDRYIVQEVSFIDADLERYTRQVGNGFWKPFLSLKQRKVQWRFFLGGMLFFWQNGSG
INAINYYSPTVFRSIGITGTDTGFLTTGIFGVVKMVLTIIWLLWLVDLVGRRRILFIGAA
GGSLCMWFIGAYIKIADPGSNKAEDAKLTSGGIAAIFFFYLWTAFYTPSWNGTPWVINSE
MFDQNTRSLGQASAAANNWFWNFIISRFTPQMFIKMEYGVYFFFASLMLLSIVFIYFFLP
ETKSIPLEAMDRLFEIKPVQNANKNLMAELNFDRNPEREESSSLDDKDRVTQTENAV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgactctccttgcgctcaaggaagataggccaacgccaaaggccgtttacaactggcgc
gtctacacatgcgcggcgattgccagttttgcctcgtgcatgattggctatgactctgcc
ttcattggcactacccttgcgctgccgtccttcaccaaggaattcgatttcgcctcttac
acacctggtgctcttgccttgctccagtccaacatcgtatccgtttaccaagctggtgcc
ttttttggatgtctattcgcttatgcgactagttacttcttgggtcgacgcaaatcccta
atcgccttctccgtcgtcttcatcattggcgccgccatcatgctcgctgctgatggtcag
gggcgaggcattgatccgattatcgcaggcagagtgctggctggaatcggcgtcggaggt
gcctccaacatggtacccatttacatctcagagcttgccccacccgccgttcgcggtcgt
cttgtcggcatttacgagctcggctggcagattggtggtctggtcgggttctggatcaac
tacggcgtcaacactacaatggccccaacgaggtcgcagtggctaattcccttcgcggtt
cagctcatccccgccggcctcttgttcttgggcagcttctggattcccgagtcgccacgg
tggctttatgccaatggcaagagagaagaggcaatgaaggtcttgtgctggattcgcaat
ctcgagcccaccgacagatatatcgtgcaagaggtttcattcattgacgctgacctggaa
aggtatacccgacaggtcggcaatgggttctggaaaccgtttttgtccctcaagcagcgc
aaggtccagtggcgcttttttcttggtggcatgctctttttctggcagaatgggagtggt
atcaatgccatcaactattactcccccaccgtattccggagcatcggcattactggtacc
gacaccggcttcttgacaacaggcatcttcggcgtcgtcaagatggtgctcaccattatc
tggcttctgtggcttgttgatcttgttggccgccgccgcatactcttcatcggtgcggct
ggcggatcgctctgcatgtggttcattggagcctacatcaagattgctgatccggggtcg
aacaaggcggaagacgcaaagctgacctctggcggcatcgcagccatcttcttcttctac
ctctggactgccttctacaccccttcatggaacggtacaccttgggtcatcaactcagag
atgtttgaccaaaacacacggtccctgggtcaggcatcagccgcggccaataactggttc
tggaactttatcatttctcgtttcacgccgcaaatgttcatcaagatggagtacggcgtg
tacttcttctttgcgtcgctcatgctgctgtcgattgtgttcatctacttctttttaccc
gagaccaaatcgatccctctcgaggccatggatcgcttatttgaaatcaagcccgttcaa
aatgccaacaagaatctcatggctgagctcaacttcgacagaaatccagagcgagaggag
tcgtcgtcgctggacgacaaggacagggtgacacagaccgagaatgcagtctaa

DBGET integrated database retrieval system