KEGG   Neurospora crassa: NCU06318Help
Entry
NCU06318          CDS       T01034                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ncr  Neurospora crassa
Pathway
ncr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    NCU06318
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ncr03041]
    NCU06318
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     NCU06318
Spliceosome [BR:ncr03041]
 Complex C
  Other components
   Step II factors
    NCU06318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 AAA_19 DUF2075 RimM AAA_14 AAA_33 AAA AAA_25 ABC_tran Herpes_ori_bp SRP54
Motif
Other DBs
NCBI-GeneID: 3878714
NCBI-ProteinID: XP_962580
UniProt: Q7SAB3
Position
Linkage Group IV; IV
AA seq 1179 aa AA seqDB search
MDDLESLELLSLVSKVTSELQNHLGVSEKTLAEFIIAQRVECGSFDEFKQKLATIGADFP
PSLVESIDRLVLTLHPKFKGQNHGQTRADENEKHGQSAEEKTKVFKGLSIPDKEVDVIDD
TLALLESLEPKRAEKERPRKRSRTPERDDYADDYGKRKRKERYRSRSRSRSRSISPPRGR
RKGRYDDEYDGDFRRPPPREVDDSPILYKVYEGHVTGIKDFGAFVNLHGVKGKVDGLVHV
SAFGQRVNHPSDLLSKGQEVKVKVIKLEGGRVGLSMKDVDQETGMDLAPQLRIGSGANME
ALGGRGGYDTKNVVTNGFGDKGAFQATANARQHKKRMTSPERWEIRQMIAAGIAKASDYP
ELEEDYQATLKGEGQMELEEDVDIEVRDEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRA
AMAGTNLAKERKELRQQETEAKKAEEKKVDLSSQWQDPMANPETRKFASDLRKNAQAAPA
APDAVPEWKRAVAPKEVSLGRRTNMSIKEQRESLPVFAFREQLITAVRENQVLIVVGETG
SGKTTQLTQYLAEAGFTNNGMIGCTQPRRVAAVSVAKRVSEEVGCQLGQEVGYTIRFEDV
TSPATKIKYMTDGMLQREILIDPDLKRYSVIMLDEAHERTIATDVLFALLKKTMKRREDL
KVIVTSATLDADKFSEYFNQCPIFTIPGRTFPVEILYSREPESDYLDAALTTVMQIHLSE
PMGDILLFLTGQEEIDTACEILYERMKALGPNVPELLILPVYSALPSEMQSRIFDPAPPG
SRKVVIATNIAETSITIDHIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRA
GRTGPGKCFRLYTEAAYQSEMLPTTIPEIQRQNLSNTILMLKAMGINDLLRFDFMDPPPV
NTMLTALEELYALAALDDEGLLTRLGRKMADFPMEPALAKVLIASVEKGCSDEMVTIVAM
LNLPNVFYRPKEKQAQADQKKAKFHDPHGDHLTLLNVYNSWKNNGYANPWCFENFIQARS
MRRAKDVRDQIVKIMDRHRHPVISCGRDTNKVRQALCAGFFRNAARKDPQEGYKTLIEGT
PVYLHPSSALFGKQAEWVVYHTLVLTTREYMHYTTSIEPKWLVEAAPTFFKMAPTDKLSK
RKKAERIEPLYNKYAGADDWRLSAQRRGGRGGGGGGTWG
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttggagagcctcgagcttctgtcgctcgtgtccaaggtcacgtccgagttg
cagaaccacttgggcgtcagcgaaaagacgctcgccgagttcatcatcgcccaacgagta
gaatgcgggtcattcgacgagttcaagcagaagttggccaccatcggcgccgacttcccg
cccagcttggttgagagtatcgacagacttgtcctgaccttgcacccaaagttcaagggc
caaaaccatggacagacccgcgccgatgaaaacgagaagcatggtcaatctgccgaggaa
aagacaaaggtgttcaagggtctgtccatcccggacaaggaagtggatgtcatcgacgac
accctggccttactcgaaagcctcgagcctaagagagcggagaaagaacgaccaaggaaa
cgaagccgcacccccgaacgagacgactatgcagacgactacgggaagaggaagcgcaag
gagcgataccggtcaaggtcgaggtcaaggtccaggtcaatttcgccaccaagaggccga
cggaagggccgatatgatgatgaatacgatggtgatttccgacggccaccaccgcgcgag
gtggacgactcccctattttatacaaggtttacgaaggccacgtcacgggaatcaaggac
tttggtgcctttgtcaacctgcatggcgttaagggcaaggttgacggcttagtacatgta
tccgctttcggtcagcgtgtcaatcacccttcggatctcttatccaagggtcaggaagtc
aaagtcaaagtcattaagctcgagggaggtagagtaggtttgtcgatgaaggacgtagac
caagagacgggcatggacctcgcaccgcaattgcggataggttcgggcgccaatatggag
gcattgggcgggagaggaggatacgatacaaagaatgttgtcaccaacggctttggtgac
aagggagcattccaagcgacagcaaatgccaggcaacacaagaagaggatgacgtctcct
gaaagatgggagattcgtcaaatgattgcggcaggcattgcaaaggcatccgattaccca
gaacttgaagaggactaccaggcaacactcaaaggcgagggacagatggagcttgaggag
gatgttgatatcgaggttcgagacgaggaacctcccttcctggctggacagaccaaacag
tcactcgagctgtcacccatccgcgttgttaaagctcccgacgggtcccttaaccgcgcc
gccatggcaggcaccaatcttgccaaagaacgaaaggaactgcggcagcaggagactgaa
gccaaaaaagcagaggagaaaaaggttgacttgtcctcccaatggcaagatcctatggcc
aacccggagaccagaaagtttgctagtgatttgcgcaaaaacgctcaagcagcaccagcg
gctcccgatgctgttcctgagtggaagagggccgttgcacccaaagaagtgtcgctaggc
aggcgcaccaacatgagcatcaaggagcaacgagaatctctccccgtctttgcctttaga
gaacaactaatcacggctgtgagggagaaccaggtccttattgttgtcggcgagacggga
tccggaaaaacgacacagcttactcaatacctggctgaagccggctttactaacaatggg
atgattggatgtacgcagcctcgccgtgtcgccgccgtgtctgttgcgaaacgtgtttct
gaagaagtcggctgccagcttggccaagaagttggttataccatcagattcgaggacgtc
accagcccagcaaccaagatcaagtatatgaccgacggtatgcttcagagagagatcctg
atcgaccccgaccttaagagatactcggtcattatgcttgatgaggcccacgaacgtacc
atcgccaccgacgtgctctttgcccttttgaaaaagacaatgaagagaagggaggacctc
aaggttatcgtcactagtgctaccttggatgccgacaagttcagcgagtacttcaaccaa
tgccccatctttaccatccctggtcgtacattccctgtcgagattctctactcccgtgag
ccagagtcagactacttggatgccgctctcaccaccgtcatgcaaatccatctcagcgag
ccaatgggcgacatccttttgttcttgacaggacaggaagaaattgacacggcttgcgaa
attctatacgaacggatgaaagccttgggccctaacgttcctgagcttctcatcttgccc
gtttactctgcccttcctagcgagatgcagagtaggattttcgacccagcgccgccaggg
agtcgaaaggttgttatcgcgaccaacattgccgagacatccatcacgatcgaccatatc
tactacgttgttgatccagggttcgtcaagcagaacgcatacgaccccaaacttggcatg
gactcgttggttgtcactcctatttcgcaggctcaagccaaccagagagccggtcgagct
ggtagaacaggaccaggaaagtgcttccgcctgtatacagaagccgcataccagtctgaa
atgttacctaccacaatccccgaaatccagcgccagaatctgtctaacaccatcctcatg
ctgaaggccatgggcatcaacgaccttctccggttcgactttatggacccacctcccgtc
aatactatgcttacagccctggaagagctctacgccctcgctgcgctggacgacgaaggt
cttttgacacgccttggaagaaagatggctgattttccaatggagccagcccttgctaaa
gttcttattgcctctgtggaaaagggctgttcagacgagatggtgactattgtcgccatg
ctcaacctccccaatgtcttttatcgccccaaggagaagcaagctcaggcggaccagaag
aaggccaaattccacgatcctcatggagatcatttgaccctcctcaacgtctacaactcg
tggaaaaacaacgggtatgcgaacccttggtgtttcgagaacttcattcaggcacgttct
atgcggcgcgccaaagatgtgcgtgaccagattgtcaagatcatggatcgccacaggcat
cccgtcatcagctgtggccgcgataccaacaaggtccggcaagctctttgcgccggtttc
ttccgcaacgcggctcgcaaggaccctcaagagggttacaagacgctgatcgaaggcacg
ccggtgtatctgcatcccagctcggcgctcttcggcaagcaagctgagtgggtcgtttat
cacaccttggtcttgaccacccgtgagtacatgcactacacaaccagcatcgagccgaag
tggctggtcgaggccgcaccaaccttcttcaaaatggcgccgaccgacaagctatcgaag
cggaagaaggccgaacggatcgaaccgctgtacaacaagtacgccggcgctgatgactgg
cgtcttagtgcgcagaggagaggcggacgtggtggtggtggcggtggtacttggggttaa

DBGET integrated database retrieval system