KEGG   Neurospora crassa: NCU06530Help
Entry
NCU06530          CDS       T01034                                 

Definition
(RefSeq) palmitoyl-protein thioesterase
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ncr  Neurospora crassa
Pathway
ncr00062  Fatty acid elongation
ncr01100  Metabolic pathways
ncr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    NCU06530
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NCU06530
Lipid biosynthesis proteins [BR:ncr01004]
 Fatty acid synthase
  Component type
   NCU06530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest PH_9 DUF915
Motif
Other DBs
NCBI-GeneID: 3877950
NCBI-ProteinID: XP_961802
UniProt: Q7S897
Position
Linkage Group IV; IV
AA seq 330 aa AA seqDB search
MAISKQLKLLLTSGSLIAAALASPVQKPLNDDDIDDTPLPLVIWHGLGDSYSAAGLREVG
ALADAINPGTLVYFIRMDDDGSRDRSATFLGNVTEQVAKACADIAAHPILSTAPAIDALG
FSQGGQFLRGYIERCNNPPVRNLVTFGSQHNGISAFRDCPWSDWVCRGAMALLKGNAWTQ
FVQSRLVPAQYYRNLDEYEQYLEHSNFLADINNERMFKNRTYRENLAKLENLVLYMFEDD
TTVVPKETAWFEEVNGTEITPLRARKMYSEDWIGLRELDRKGGLHFRTAPGDHMQLTDQL
LNETFAEFFGPIKKAKKSAPRPLMLGGGDL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccaagcagctgaagctgttgcttaccagcggctcgcttatcgcagccgcg
ctggccagtcccgtacagaagccactcaacgacgacgacatcgacgacacaccactgcct
ctcgtcatctggcatggcctaggagacagctactcggccgcgggcctccgcgaagtcggc
gcccttgccgacgccatcaaccccggcacgctcgtctactttatccgtatggacgatgac
ggcagccgcgatcgttccgccaccttcctcggcaacgtgaccgagcaagttgccaaagcc
tgtgccgacatcgccgcgcacccgatcctttctacagcgcccgccatcgacgccctcggc
ttcagccaaggcggccagtttctgcgggggtacatcgagcgttgcaacaatccacccgtc
cgcaaccttgttacttttggctcccaacacaacggcatcagcgccttccgcgactgcccc
tggtccgactgggtttgccgcggcgccatggcgctgctcaagggtaacgcctggacgcag
tttgtccagagccggctcgtacccgcgcagtactatcgtaacctggacgagtacgagcaa
tatcttgagcactccaatttcctagcggacatcaacaatgagcggatgttcaagaaccgg
acctacagggagaacctggccaagctggagaatctggtactgtacatgtttgaggacgac
acgacggtggtacccaaggagacagcttggtttgaagaggttaatggcaccgagatcacg
cccctccgtgcgaggaagatgtactcggaggactggatcgggctgcgtgagttggatcgc
aaaggcggattgcacttccgcacggcgccgggcgatcatatgcagcttacggaccagttg
ctgaatgagacgtttgccgagttctttgggccgataaagaaggccaagaagagtgctccg
aggccgcttatgcttgggggcggtgacctctga

DBGET integrated database retrieval system