KEGG   Neurospora crassa: NCU06558Help
Entry
NCU06558          CDS       T01034                                 

Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
ncr  Neurospora crassa
Pathway
ncr00260  Glycine, serine and threonine metabolism
ncr00330  Arginine and proline metabolism
ncr00472  D-Arginine and D-ornithine metabolism
ncr01100  Metabolic pathways
ncr01130  Biosynthesis of antibiotics
ncr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCU06558
   00330 Arginine and proline metabolism
    NCU06558
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NCU06558
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    NCU06558
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NCU06558
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     NCU06558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 Thi4 Pyr_redox_2 GIDA Pyr_redox HI0933_like Pyr_redox_3 FAD_oxidored FAD_binding_3 NAD_binding_9 ApbA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 3878423
NCBI-ProteinID: XP_962265
UniProt: Q1K8F1
Position
Linkage Group IV; IV
AA seq 380 aa AA seqDB search
MLPVDPKNLSSPLVTLSTMSTIVVVGAGVSGLTCALQLAKQGGNTITVVAKHMPGDYDPE
YTSPFAGANVLPMAPEYNRWEGETWPELKRLAETCPEAGIHFQKAVLYRRAQDEAAGFAG
PLSDGLFVRNPWYKDLVPDYVDLPASEVPEGMSSASSFTSVCINTAIYLPWLVGQCRARG
VVFKRAVLKHISDAAKLSHTGRKPDIIINATGLLSCRLGGVMDKKVMPARGQVVLVRNEA
TPNMVCTSGTDDGNGDELCYIMQRAAGGGTILGGTYMKGNWDGVPDPNIATRIMKRAVEA
CPALTGGKGIEALDVIRHAVGLRPYREGGVRIDKENINGTWVVHNYGHGGWGYQGSWGCA
FRVQELVDEIKSELKLGSKL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctccctgttgaccccaagaatttgtcctcgcccttggttacattatccacaatgtcc
actattgttgttgtaggcgccggcgtgagcggcctcacttgcgcccttcaactagccaag
caaggaggaaacaccatcaccgtagtagccaagcacatgcccggcgactatgacccggag
tacacctctcccttcgcgggcgccaacgtcctgcccatggcccccgaatacaaccgctgg
gaaggcgaaacctggcccgaactgaaaagactcgctgagacctgtcctgaagccggcatc
cacttccaaaaggccgtcctctaccgacgcgcccaagacgaagccgccggcttcgcgggc
cccttgtccgacggcctctttgtgcgcaatccgtggtacaaagacctggtgcccgactac
gtcgacttaccggcctccgaggtgccagagggcatgtcctccgcctcttcttttacttcg
gtctgcatcaacacggccatctacctcccctggctggtgggccagtgccgggcacgcggc
gtggtgtttaagcgggccgtgctcaagcacatctccgacgccgccaagttgagccacacg
gggcgcaagccggatatcatcatcaacgccacgggcttgctgagttgtcggctgggcggc
gtcatggacaaaaaagtgatgcccgcgcgcggacaggtggtgctagtccgcaacgaggcg
acgccaaacatggtgtgcacgagcggcacggacgatgggaacggcgatgagttgtgctac
atcatgcagcgagctgcaggtgggggcacgattcttggaggtacctacatgaagggtaac
tgggacggcgtgccagatccgaacattgcgacgaggatcatgaagcgcgccgtggaggcg
tgcccggcgttgacgggtggaaaaggtatcgaggcgctggatgtcattaggcatgcggtg
gggctgaggccatatagagagggcggcgtgaggatcgacaaggaaaacatcaatgggacg
tgggtggtgcataactatggacatggcggatggggatatcagggcagctgggggtgtgcg
tttagggtgcaggagctggtggatgagattaagagtgagttgaagcttggctctaagctc
tag

DBGET integrated database retrieval system