KEGG   Neurospora crassa: NCU07318Help
Entry
NCU07318          CDS       T01034                                 

Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ncr  Neurospora crassa
Pathway
ncr00051  Fructose and mannose metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCU07318
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     NCU07318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA Telomere_reg-2 DUF2293
Motif
Other DBs
NCBI-GeneID: 3878624
NCBI-ProteinID: XP_962476
UniProt: Q7SA44
Position
Linkage Group IV; IV
AA seq 398 aa AA seqDB search
MAANNYTKKAVHFGAGNIGRGFVACFLHNSGYEVIFADVNADLINALNASPSYKVIEVGS
EGTEESTITNYRAINSRTNEEELIQEIATAEVVTCSVGPNILKFIAPVIAKGIDRRSEDL
PPVAVIACENAIGATDTLAEYIKDPKNTPSHRLENYEKRARFANSAIDRIVPAQDADAGL
DVKLEKFYEWVVDRTPFKDMSPPDIKGINWVDNLLPYIERKLYTVNTGHATAAYHGYIRR
KSTVYDALQDKDIQEEVKKALENTSHLITQKHGIDEQAQHEYVEKIVRRISNPHLEDAVE
RVGRAPLRKLSRKERFIGPAAELAEHGKDCSALLDAAEMAFRFQNVEGDEESAELAKIMA
SNKPEDVVKQVCGLNEQEKLFPKVVEVVQRVQADLHDD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaattataccaagaaggcggtgcactttggtgctggcaacattggtcgt
ggtttcgttgcctgcttccttcacaactctggatacgaagtcatctttgctgatgtcaac
gccgacctaataaacgccctcaatgccagcccctcctacaaggttatcgaggtgggaagc
gagggaacggaggaatcgaccatcaccaactaccgcgccatcaactctcgcaccaatgag
gaggagcttatccaggaaatcgccacggctgaagtggtgacttgctccgtcggccccaac
atcctcaagttcattgcccctgtcattgccaagggtatcgaccgcagatccgaggacctg
ccccctgtggctgtcattgcctgcgagaatgccattggggcgacggatactcttgccgag
tacatcaaggaccctaagaacactccctcgcaccggttggagaattatgagaagcgcgcc
cgtttcgccaactcggccatcgatcgcattgttccggcccaagatgccgacgcaggcttg
gatgtcaagcttgagaagttttatgagtgggtggtcgaccgcactcccttcaaggacatg
tcgccgcccgacatcaagggcatcaactgggtcgacaacctgctgccctacattgagcgt
aagctctacactgtcaacaccggccacgcgacggccgcctaccatggttacatccgccgc
aagagcaccgtctatgatgctctccaagataaggacatccaggaagaggtcaagaaggcg
ctcgagaacacatcccacctcattacgcaaaagcacggcatcgacgaacaggcccagcac
gagtacgttgaaaagattgtcaggcgcatcagcaaccctcacctggaggatgccgtcgag
cgcgtgggccgtgctcccctacggaagctgtcccgcaaggagcggttcatcggccccgca
gccgagcttgccgaacacggtaaggactgcagcgctctgctcgatgctgctgagatggcg
ttccgcttccagaacgtcgagggcgacgaggagtcggccgaacttgctaagatcatggcg
agcaacaagcccgaggacgttgtcaagcaggtctgcggcttgaacgagcaggagaagctg
ttccccaaggtggtcgaggttgtacagcgcgtacaggccgacttgcacgacgactag

DBGET integrated database retrieval system