KEGG   Neurospora crassa: NCU07340Help
Entry
NCU07340          CDS       T01034                                 

Gene name
cbh-1
Definition
(RefSeq) cellobiohydrolase-1
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
ncr  Neurospora crassa
Pathway
ncr00500  Starch and sucrose metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU07340 (cbh-1)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     NCU07340 (cbh-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7 CBM_1
Motif
Other DBs
NCBI-GeneID: 3878646
NCBI-ProteinID: XP_962498
UniProt: Q7SA23
Position
Linkage Group IV; IV
AA seq 521 aa AA seqDB search
MLAKFAALAALVASANAQAVCSLTAETHPSLNWSKCTSSGCTNVAGSITVDANWRWTHIT
SGSTNCYSGNEWDTSLCSTNTDCATKCCVDGAEYSSTYGIQTSGNSLSLQFVTKGSYSTN
IGSRTYLMNGADAYQGFELLGNEFTFDVDVSGTGCGLNGALYFVSMDLDGGKAKYTNNKA
GAKYGTGYCDAQCPRDLKYINGIANVEGWTPSTNDANAGIGDHGTCCSEMDIWEANKVST
AFTPHPCTTIEQHMCEGDSCGGTYSDDRYGGTCDADGCDFNSYRMGNTTFYGEGKTVDTS
SKFTVVTQFIKDSAGDLAEIKRFYVQNGKVIENSQSNVDGVSGNSITQSFCNAQKTAFGD
IDDFNKKGGLKQMGKALAKPMVLVMSIWDDHAANMLWLDSTYPVEGGPGAYRGECPTTSG
VPAEVEANAPNSKVIFSNIKFGPIGSTFSGGSSGTPPSNPSSSVKPVTSTAKPSSTSTAS
NPSGTGAAHWAQCGGIGFSGPTTCQSPYTCQKINDYYSQCV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaagttcgctgcccttgcggcccttgtggcctctgccaacgcccaggctgtt
tgctctctcactgccgagacccatccctccctcaactggtccaagtgcacttcctccgga
tgcacgaacgtcgccggatccatcactgttgatgccaactggcgctggactcacattact
tctggtagcaccaactgctacagcggcaacgagtgggacacctccctctgcagcaccaac
accgattgcgcgaccaagtgctgcgttgatggtgctgagtactcttctacctatggtatt
cagaccagcggcaactcgctcagccttcagttcgtcaccaagggctcgtactcgaccaac
attggttcccgtacttaccttatgaacggtgccgatgcctaccagggcttcgagctcctt
ggcaacgagttcaccttcgatgtcgatgtgtccggcaccggctgcggtcttaacggcgcc
ctctacttcgtctccatggatcttgatggtggcaaggccaagtacaccaacaacaaggct
ggtgccaagtacggtaccggttactgcgacgctcagtgcccccgtgatctcaagtacatc
aacggtatcgccaacgttgagggctggaccccctccaccaacgatgctaacgctggtatt
ggtgaccacggtacttgctgctctgagatggatatctgggaagcgaacaaagtctctaca
gcgttcaccccgcacccctgcaccaccatcgaacagcacatgtgcgagggtgactcctgc
ggtggtacctattccgacgaccgctatggcggtacttgcgatgccgatggttgtgacttc
aacagctaccgcatgggcaacaccaccttctacggtgagggcaagactgtcgataccagc
tccaagttcaccgttgtcacccagttcatcaaggactccgctggcgatcttgctgagatc
aagcgcttctacgtccagaacggaaaagtcattgagaactctcagtccaacgttgatgga
gtttctggcaactccatcacccagtctttctgcaatgctcagaagactgctttcggcgat
atcgatgacttcaacaagaagggtggcctgaagcaaatgggcaaggcccttgccaagccc
atggtcctcgtcatgtccatctgggacgaccatgccgccaacatgctctggctcgactcc
acctaccctgtcgagggtggccccggtgcttaccgtggcgagtgccctaccacctcgggt
gtccccgctgaggtcgaggccaatgctcccaactccaaggtcatcttctccaacatcaag
ttcggccccatcggctctacctttagcggcggctcttccggcacccctccttccaaccct
tcgagctccgtcaagcccgtcacctccactgctaagccttcttccacctctactgcctcc
aaccccagcggtaccggtgctgctcactgggctcagtgcggtggtattggcttctctggc
cccaccacttgccagagcccttacacttgccaaaagatcaacgactattactcccagtgc
gtgtaa

DBGET integrated database retrieval system