KEGG   Neurospora crassa: NCU07874
Entry
NCU07874          CDS       T01034                                 

Definition
(RefSeq) nuclear and cytoplasmic polyadenylated RNA-binding protein pub1
  KO
K13201  nucleolysin TIA-1/TIAR
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncr03019]
    NCU07874
   03041 Spliceosome [BR:ncr03041]
    NCU07874
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     NCU07874
Spliceosome [BR:ncr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    NCU07874
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded Nup35_RRM_2 RRM_7 RRM_8 Cas_Cas2CT1978 RRM_3
Other DBs
NCBI-GeneID: 3878871
NCBI-ProteinID: XP_962723
UniProt: Q7SAS0
Position
Linkage Group III; III
AA seq 480 aa
MADVGPPPTTGQLPPPPQPNAGAPGYENGQNNNANSAHMPPPPLHIPQNTNPIPTAITSP
MGGNGDTSGIMSPTSAGNPFGRRAAPEPNKRALYVGGLDPRVTEDVLRQIFETTGHVQNV
KIIPDKNQKGYNYGFVEYDDPGAAERAMQTLNGRRVHQSEIRVNWAYQSNNQNKEDTSGH
FHIFVGDLSNEVNDEVLLQAFSAFGSVSEARVMWDMKTGRSRGYGFVAFRDRPDAEKALS
SMDGEWLGSRAIRCNWANQKGQPSIAQQQAMQQMGLTPTTPYGHHHFPTHGVHSYDMIVA
QTPAWQTTCYVGNLTPYTTQNDLVPLFQNFGYVVESRFQADRGFAFIKMDTHENAAMAIC
QLNGYQVNGRPLKCSWGKDKTPNPQQFDPNQPYSPQSAQTPGYPGTPSTYFNNYGNSYPG
QQGNYNGPQAQSPAGYGSQMGYNGPPSAGGYGRGQPGPNAQWNQPSPAQNFGNGFGGYQG
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctgacgttggcccgcctcccaccaccggacagcttccccctccacctcaaccaaac
gcaggcgcgcccggctacgagaacggtcaaaacaacaacgcgaattccgcacacatgcct
cctccgccgctgcacatcccgcaaaacaccaatcccatccctacggcgattacgtcgccc
atgggtgggaacggtgacacgagcggcatcatgtcgcccaccagcgccggcaaccccttc
ggccgccgcgccgcccccgagccgaacaagcgcgctctctacgtcggcggccttgaccct
agggtcaccgaggacgtcttgagacagattttcgagacgactggccatgtccagaatgtc
aaaattattcccgacaagaaccaaaagggctacaactacggcttcgttgagtatgatgat
cccggtgcggctgagcgtgctatgcagacgctcaacggtcggcgcgtgcatcagtccgaa
atccgtgtcaactgggcctaccagtcgaacaaccagaacaaggaggatacttcgggccac
ttccacatcttcgtcggcgatctctccaacgaagtcaacgacgaggttctgcttcaggcc
ttttctgcctttggctccgtctccgaggctcgagtcatgtgggacatgaagactggtcgc
tcccgcggctatggcttcgttgctttccgcgaccgtcccgatgccgagaaggctctgagc
tctatggatggcgaatggcttggatctcgtgccattcgttgcaactgggccaaccagaag
ggtcagccttccattgctcaacagcaagctatgcagcagatgggtcttactcccaccact
ccttatggccaccaccacttccctacccacggagttcacagctatgacatgattgtcgcc
cagacccctgcttggcagacgacctgctatgtcggcaacctgactccttacaccactcag
aatgacctcgtgccccttttccagaacttcggctacgtcgtcgagtctcgtttccaggcc
gatcgcggctttgcattcatcaagatggacactcacgagaatgctgccatggccatctgc
cagcttaatgggtatcaggtcaatggtcggcctttgaagtgcagctggggcaaggacaag
acgcccaaccctcaacagttcgacccaaaccagccttatagccctcagagtgcccagacg
cctggttatcccggcactccctccacttatttcaataactatggcaactcttacccaggc
cagcaaggtaactacaacggccctcaagctcagtcacctgccggctacggctcccagatg
ggttacaacggcccgccgagcgctggtggttatggccgtggtcagcccggtcccaacgcc
cagtggaaccagccgtccccagcccagaacttcggcaatgggtttggtggttaccagggc
tag

DBGET integrated database retrieval system