KEGG   Neurospora crassa: NCU07937Help
Entry
NCU07937          CDS       T01034                                 

Definition
(RefSeq) sphingoid long chain base kinase 4
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ncr  Neurospora crassa
Pathway
ncr00600  Sphingolipid metabolism
ncr01100  Metabolic pathways
Module
ncr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NCU07937
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     NCU07937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 3878585
NCBI-ProteinID: XP_011394278
UniProt: V5ILX8
Position
Linkage Group IV; IV
AA seq 570 aa AA seqDB search
MGDVRQLRDEHAAAIAKASAQEPSIQAVALQATTSASGKNVAILELPTVTLTCEKDHLVI
QEHTAATKKSRSCCPVTPSRRLAPGSVPFYNILWAYITPDRNYLRIDFAEETSPKKHQLI
VRQLEFPLPSASLQGAREREPLLSPPSIPPVSAATLDAFVARVLDLAYPAPIQRRKRAWV
LVNPHAGPGGADKIFEKKVRPIFEAARMPLTVVRTTYSGEAVTLAQDLDISEYDIAIPCS
GDGLPHEVFNGLSKRPDARKALAKLAVCHIPCGSGNAMSCNLYGTHRPSLAALAIVKGVP
TKLDLCSVTLQDGERLTSFLSQAYGLIADLDITTEHLRWMGAARFTYGFLTLAIRKKTYP
CDVAMKVEVGGKEEIRGHYARGVKGAESDVGNGEASGDGEEGGSSDGEGEGEGEGMPGLK
YGTVNDKLPEDWEVVPHEKLGSFYCGNMAYMAPDANFFSAALANDGLLDLITTDGDISLW
KNINLQLSVESGHFFDNPLVSYRKVSAFRLTPRYQDPNGVISIDGEARPFAPFQVEVHKG
LGLTLSKRGVFEAPGPHGWDKVTTTERLMA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgttcgacaactacgggatgaacacgcggcagccattgcgaaggcgagcgcg
caagagccgtccattcaggccgtggcattgcaagccactacttctgcttccggaaagaat
gtcgctattctcgaactgcccactgtcacactcacttgcgagaaggatcacttggtgatt
caagaacatactgctgccaccaagaagtcacgttcgtgctgcccagtcaccccttcgcgc
cgtctcgctcccgggtccgtaccattctacaacattctctgggcctacatcacccccgac
cgcaactacctccgcatcgacttcgccgaagagacctctcccaagaaacatcagctcatc
gtccgccaactcgagttccccctcccctcagcctctctccaaggtgcccgagagcgcgag
ccacttctctcaccaccctccatccctccagtctccgccgccaccttagacgcctttgtc
gcccgcgtcctcgacctcgcctaccctgcccccatccagcgccgcaagcgcgcctgggtg
cttgtcaacccgcatgccggccccggcggcgccgacaagatttttgaaaagaaggtccgc
cccatcttcgaagcggcacgcatgccattgaccgtcgtccgcaccacctactccggcgaa
gccgtcaccctcgcgcaggacctggatatttcagagtacgacatcgcaatcccctgctcc
ggcgacgggctaccgcacgaagtcttcaatgggctctccaagcggcccgatgcccgcaag
gcgcttgccaagctagcagtgtgccacataccctgcggctcgggcaacgccatgagctgt
aacctctacggtacccaccgcccttcgctggcggcgctagccatcgtcaagggcgtgccg
acgaagctggacctgtgcagcgtcacgctgcaagatggagagcgtctgacgagctttctg
agccaggcgtacggcttgattgccgatttggatatcactaccgagcatctgaggtggatg
ggtgcggcgaggtttacgtacgggtttttgacgctggctatcaggaagaagacgtatccg
tgtgatgtggcgatgaaggtggaagtgggcgggaaggaggagattagggggcattatgcg
aggggggtgaagggggcggagagtgatgttgggaatggggaggctagcggggatggggag
gagggtggtagtagcgatggggaaggagaaggagagggagagggaatgccggggttgaag
tatggaacggtgaatgataagttgccggaggattgggaggtggttccgcatgaaaagttg
gggagcttttactgcggtaatatggcctacatggccccagacgccaacttcttctccgcc
gccctcgccaacgatggtttgttggacctcatcacgaccgacggcgacatctccctctgg
aagaacatcaacctccaactctcggtcgaatcaggccacttcttcgacaaccccttggtt
tcctatcgcaaggtctccgctttccgcttgacaccccgataccaggacccgaatggagtg
atcagcatcgatggcgaagcgcgaccgttcgctcccttccaggtggaggtacacaagggc
ctggggctgaccctcagtaagaggggtgtgttcgaagcgccggggccgcatgggtgggac
aaggtcacgacgacggaaaggttgatggcctag

DBGET integrated database retrieval system