KEGG   Neurospora crassa: NCU08270Help
Entry
NCU08270          CDS       T01034                                 

Gene name
dcl-1
Definition
(RefSeq) dicer-like protein 1
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncr03036]
    NCU08270 (dcl-1)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     NCU08270 (dcl-1)
Chromosome and associated proteins [BR:ncr03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    NCU08270 (dcl-1)
   microRNA pathway
    RISC loading complex
     NCU08270 (dcl-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 Dicer_dimer Helicase_C ResIII DEAD AAA_22 ERCC3_RAD25_C Fructosamin_kin DUF2322
Motif
Other DBs
NCBI-GeneID: 3878050
NCBI-ProteinID: XP_961898
UniProt: Q7S8J7
Position
Linkage Group IV; IV
AA seq 1584 aa AA seqDB search
MAVATRLPFIPPEATSQIIGGDEDLIDLSQEDVVSDNDDRGNASDVESEDGVKRWTVNPE
PKPKKISAKKLADTAAFNSWIEEHQETLARDQRKAAIEAARVAGVDVLPAIGFDSERIIT
SPREYQVELFERAKQQNTIAVLDTGSGKTLIAAMLLRWVITGELEDREKGLPRRIAFFLV
DKVALVFQQHSFLTKNLDFPMEKLCGEMVEGVESKAFWKEALEQNEVVVCTAEILSTALH
HSWIRMDQINLLIFDEAHHTKKDHPYARIIKNFYIDEQLERRPRILGLTASPVDAKVDPR
RAAAELEALLHSQIATAADPAALQHTICKPKTELVVEYVRGRPDSETVLNKQLRKLVGGQ
ELFKKPLNFTTSAASKLGTWCADRYWQLFFKQEDIVKLESRTERDLMKVAALDEITEKHV
KQVREAHELVNAHTFSPAALDPTMLSSKVIMLVRILRDQFERGVGAQRCIIFVRQRNTAM
LLADLLQQPEIKSHIPSIAAEVLVGGGTTGSSYVNAKINFQQQNRIIRKFKLGEINCLFA
TSVAEEGLDIPDCNIVIRFDLYDTLIQCIQSRGRARRPDSRYIQMIEKGNYEHHSRILRA
KGAEDVLRKFCEALPEDRKLTGNHMNLDYLLRKEKGKRQYTVPDTGAKLSYMQSLVCLAN
FTATLPHPPETSLSPEYYITTVPGGFQCEVVMPDASPIKSAVGKVHLSKGVAKCAAAFEL
CLALLKAGHLDNHLQSVFTKQLPEMRNARLAVSSKKKTEYAMRLKPELWSVRGVVTQLFA
TAFVLENPDTLGRSSRPLLLLSRSALPEVASFPLFFGTKRFSKVRCVPIPGSVQADDTLV
EQLTRFTLKAFMDVFSKEYEATAVNLPYFLSPMDGGHGFDFRLAKSPAHLIDRKALAYVS
ENEKVPYTFLEPDDFFQDKFVVDPYDGARKFFTHHRRHDMKPTDPVPDGIVAPNHRAWRG
LGTTHDILNYSNSLWSKSRGFMIFQADQPVVEAALISTRRDFLDDTLRDEDVEPQQCFLI
LEPMRISPIPADVVAMLLCFPSIIHRVESNLVALDACKLLGLDLRPDLALEAFTKDSDNS
DEHDAEKENFQTGMGDNYERLEFLGDSFLKMATTIAIYTLIPDKGEFEYHVERMLLICNK
NLFNNALEIGLEEYIRSMSFNRRQWYPEGLILKKGKSKDARQRHVLADKSIADVCEALIG
AAYLTGQEKGSFDMAIKAVTAMVKDKKHRMISYGDYYAVYQKPTWQTESANSAQRDMAKK
FSERMGYKFKHPRLLRAAFQHPTYPSLYERLPSYQRLEFLGDALFDMVAVDYLFRKFPAA
DPQWLTEHKMAMVSNQFLCCLSFHLGFNKCIATMSPSILKDIAEYVTEIEEALETAKQEA
INAGKTADEYSRDYWVHITHASRLPKCLSDVVEAYIGAIFVDSEYDYSVVQNFFNMHVLP
FFEDMHLYDTFANKHPVTFVANMMAHKFRCNEWRSFAKELDTDVTEGRGGRGGNGAVAGE
ISEINPPKVVSALLVHGKTVVHAVAASGRYAKSAMAKKAIKLLEGMSVEEFRERLGCNCK
GVPMEVDGGVPEADVDGEVHGTAV
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atggccgtagccactcggctaccctttatcccaccggaggcgactagccagataatcggc
ggcgatgaagatttgatagatctctcccaagaagatgtggtctccgacaacgacgacaga
ggaaacgcctctgatgtcgagagcgaggacggcgttaaaagatggacagtgaacccggaa
cccaagcccaagaagatttcggccaagaagcttgccgatactgctgctttcaactcgtgg
atcgaggagcaccaggaaactctggcaagagaccaaagaaaagccgcgatagaagcggca
agggtggccggcgtggacgtgttgcccgctattggctttgatagcgagagaatcatcact
tcaccacgagaatatcaggtggagctttttgaacgtgcaaaacagcaaaacacgattgct
gttctggatacaggatccggaaagactctgatcgccgccatgttgttacgctgggtcatt
actggtgaattggaggaccgagaaaagggtttacccagacggattgccttcttcctggtc
gacaaggtggccttggtgttccaacaacacagctttctcaccaagaacctcgatttccca
atggagaaactatgcggtgagatggtggaaggtgtcgaatcaaaagctttctggaaggaa
gcattggagcaaaacgaagtggttgtctgtacagctgaaatcctcagcacagcgctccat
cattcctggattagaatggaccagatcaacctcttgatcttcgacgaagcccaccatacg
aaaaaagatcatccgtatgctcgcatcatcaagaacttttatattgatgagcagctggag
agaagacccagaatccttggcttgacggcctccccggttgacgcgaaggttgacccgagg
cgggctgcggcagaactggaggcgttacttcacagccaaatagccacggccgccgacccg
gccgcccttcagcatacgatttgcaaacccaagaccgagttggttgttgaatacgttcgt
ggtcgaccagactcggagacagtcctcaacaagcaattacgcaaacttgttggaggacaa
gagctgtttaagaagccgctcaactttactacctcggctgcatctaaattgggaacatgg
tgtgccgaccggtattggcaacttttcttcaaacaagaggacatagtcaaactggaatca
cgcactgagagagatctcatgaaagtcgcagccctcgatgaaatcaccgaaaagcacgtc
aagcaagtccgtgaagctcacgagttggttaacgcgcatacattttcacccgctgctctc
gatccgacgatgttgtcgtccaaggtcatcatgcttgttagaatcttgcgtgatcagttc
gagaggggcgtgggtgcgcaaagatgcattatttttgtccgacagcggaacacggcgatg
ctgttggcggatttgctccagcagcctgagataaagtctcacatacccagcattgcagca
gaagtcttggttggaggtgggacaactggctcaagctatgtcaacgccaagatcaacttc
cagcaacaaaacagaataattcgaaagttcaagcttggcgagataaactgcctatttgct
acttctgttgctgaggaaggtctcgatattccagattgcaatatcgttatcagattcgat
ctctatgatactctgattcagtgtatccagtcgcgtggtcgagctcgtcgtccagattct
cgctacatccagatgatcgaaaaagggaattacgagcaccactccaggatattgcgagct
aaaggggctgaagatgtcctgcgcaagttctgcgaggctctacccgaagacaggaagctg
actggcaaccatatgaacttggactatctgcttcggaaggaaaagggcaagaggcagtac
actgtcccagatactggtgcgaaactcagctatatgcaaagccttgtctgtctcgccaac
ttcaccgccaccctaccacacccaccggagacgagtttgagtccggaatactacatcacc
actgttcctggtggctttcagtgcgaggtcgtcatgcctgatgcatcacccatcaagagc
gcggttggcaaagtacatttaagtaagggggtggccaaatgtgcagctgcattcgagctt
tgccttgctttactcaaggctggccacttggataaccacctccagtctgtgttcaccaag
cagctaccggaaatgcggaatgctcgccttgctgtcagctcaaagaagaagacggagtac
gccatgcgtctgaagcccgaattatggtcggttcgaggcgtggtcacgcagctttttgcc
actgcgtttgttctggagaacccggacacccttgggcgtagctctcgtcctcttctcctg
cttagtagaagcgctctcccagaagtggcttcctttccgctcttttttggcactaagcgc
ttttccaaagtccgctgcgtgcctatcccaggttctgtccaggctgacgatacgttggtg
gagcaacttactcgtttcaccctgaaagctttcatggatgttttcagcaaggaatacgag
gcgacagcagtcaaccttccgtactttctctctccaatggacggtggtcacgggtttgac
ttccgcttggccaagagcccagctcacctcattgaccgaaaagcgctagcatacgtcagt
gagaacgagaaggtgccatacacgtttcttgagccagatgattttttccaagacaagttt
gtagttgacccatacgacggagcacggaagttctttactcatcaccgtcgccatgacatg
aaacccacggatcccgtgccagatggtattgttgcaccgaatcacagggcttggagaggc
ttaggcaccacacatgacattctgaactacagcaacagcttatggtcaaagtcgcgtggc
tttatgatattccaggcggatcagcctgtcgtggaggctgcgcttatttccactcgtcga
gactttctcgacgatacgctgagggatgaggacgtggaaccacaacagtgtttcctgatt
cttgaacccatgaggatttcacctataccagcagatgtggtggcaatgcttctctgtttc
ccgtcaatcatacaccgggtagaatcgaatctagttgcattggacgcatgcaagcttctg
ggtctagacttgcgcccagacctcgcccttgaggccttcaccaaggacagcgataactcg
gatgaacacgatgccgagaaggaaaactttcaaactggaatgggtgacaactacgagaga
ctcgagtttcttggtgactccttcttgaaaatggcaacaaccattgccatatataccttg
atccctgacaagggcgaattcgagtatcatgtcgagcgtatgctccttatctgcaacaag
aacctattcaacaacgccctagagatagggctcgaagaatacatccggtccatgtcattt
aaccgcagacaatggtatccggagggcctaattttgaagaagggcaagagtaaggacgcg
cgtcagcggcatgtcctggccgacaagtccattgctgacgtttgcgaggccctcattggc
gccgcctaccttacaggccaagagaagggcagctttgacatggcgatcaaggctgtaact
gccatggtcaaagacaagaagcaccgcatgatcagctacggcgactactacgccgtatat
caaaagccaacctggcagacggaatcagccaatagtgcccagcgcgacatggccaaaaag
ttttccgagcgcatgggctacaaattcaagcacccgcgtctcttgcgcgcagccttccag
cacccgacgtacccgtccctctacgaacgtctcccctcgtaccaacgcctcgaattcctc
ggcgacgcgctcttcgacatggtcgctgttgattacctcttccgcaagttccccgccgcc
gacccgcaatggctaacggagcacaaaatggccatggtgtccaaccagtttctgtgctgc
ctctccttccacttgggattcaacaagtgcatcgccaccatgtcgccctccatcctcaag
gacatcgccgagtatgtgaccgagatagaagaagcacttgagacggccaagcaggaggct
atcaacgcaggaaaaaccgcagacgagtatagcagggattactgggtgcacatcacacac
gcttctcgcttgcccaagtgcctgtcggacgtggtggaggcatacattggcgccatcttc
gttgacagcgagtacgattactccgtagtccaaaacttcttcaacatgcacgttctgcct
tttttcgaggatatgcatctttatgataccttcgccaacaaacatcccgtcacctttgtg
gcgaacatgatggcgcacaagttccgctgcaacgagtggagaagctttgccaaggagctg
gacacagatgttacggaaggaagaggtggaagagggggcaatggtgcagtggctggtgag
attagtgagatcaatccgcccaaggtggtctcggcgctactggtacatggcaagacggtg
gtgcatgcggtggcggccagtggacggtatgcaaagtcggctatggcgaagaaggctatc
aagcttttggagggcatgagcgtggaggagttcagggagaggttggggtgtaattgtaag
ggggtgccgatggaggttgatggaggagtgccagaggcggatgtggatggagaggtacat
ggcacggcggtttag

DBGET integrated database retrieval system