KEGG   Neurospora crassa: NCU08325
Entry
NCU08325          CDS       T01034                                 

Gene name
pho-5
Definition
(RefSeq) phosphorus-5
  KO
K08176  MFS transporter, PHS family, inorganic phosphate transporter
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ncr02000]
    NCU08325 (pho-5)
Transporters [BR:ncr02000]
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Phosphate:H+ symporter (PHS) family [TC:2.A.1.9]
    NCU08325 (pho-5)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 3878688
NCBI-ProteinID: XP_962538
UniProt: Q7RVX9
Position
Linkage Group IV; IV
AA seq 570 aa
MSTPQKTAGGNNAYHNFYNDFLHIKDPNERRRLALAEVDRAPFGWYHVRAVAVAGVGFFT
DSYDIFTVSLLTLMLGIVYFPGEGKMPTTSDTAIKLATSAGTVIGQVGFGAAADVFGRKS
MYGLELLFIIFATLAQALASGSPSINIIGIIIFWRVLMGVGIGGDYPLSSIITSEFATTK
WRGAMMGAVFAMQGLGQLAAAFVMLFVTLGFKKSLEAAPTLASCTGDCAVAVDKMWRTVI
GVGAVPGCIALYYRLTIPETPRYTFDVKRDVEQASDDIEAFKTGKPKGQPDEATRIVAKQ
EAEKEMEIPKASWGDFFRHYSKRKNAMLLAGTALSWCFLDIAYYGVSLNNATILNVIGYS
TTGAKNTYEILYNTAVGNLIIVLAGAVPGYWVTVFTVDTVGRKPIQFMGFGILTILFVVM
GFAYKHLSPHALLAIFVLAQFFFNFGPNATTFIVPGEVFPTRYRSTSHGLSAAMGKIGSI
IGQGAIAPLRTRGAVKGGNPNPWMNHVLEIYALFMLLGVGTTFLIPETKRKTLEELSGEF
DMSGEEEAQRDTTLTEHKTEAPTSSAAVNA
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgagtacccctcagaagactgccggaggcaacaacgcctaccacaacttttacaatgac
tttcttcacatcaaggatcccaacgagaggcgacgactcgccctcgccgaagtcgacaga
gcgccattcggatggtatcacgttcgggccgttgccgttgccggtgtcggtttcttcaca
gactcttacgacatcttcaccgtctctcttttgaccctcatgctcggcattgtctacttc
ccaggcgaaggcaagatgcctacaacctccgacacagccatcaagctcgcaacatcggcc
ggcacggtcattgggcaggtcggcttcggcgccgctgctgatgtctttggtcgtaagagc
atgtacggattggaattgttgttcatcatctttgccactctcgctcaggccttggcctcc
gggtcaccttccatcaacatcatcggtatcattatcttctggcgtgttcttatgggggtc
ggtatcggtggagactatcctctttccagtattatcacctccgaatttgctacaaccaag
tggagaggtgccatgatgggtgccgtctttgctatgcaaggtcttggccagcttgctgcc
gcattcgtcatgttgttcgttacactcggtttcaagaagtcgcttgaggccgcccctact
ctggcttcgtgcaccggagactgtgccgttgccgttgacaagatgtggaggacagtcatt
ggtgtcggtgctgttcccggctgcatcgcgctctactaccgcttgactatccccgagact
cctcgctacaccttcgacgtcaagagggatgttgagcaggccagtgacgacatcgaagcc
ttcaagacgggcaagcccaagggccagcccgacgaggccacccgcatcgtcgctaagcag
gaggccgaaaaggagatggagatccccaaggccagctggggcgacttcttccgccattac
tccaagcgcaagaacgccatgctgctcgccggcaccgccctgtcttggtgcttcctcgac
atcgcctactacggcgtctcgctcaacaacgccaccatcctcaacgtcatcggctactcc
accacaggtgccaagaacacgtacgagatcctctataacaccgccgtcggcaacttgatc
attgttctcgccggcgccgtccccggatactgggtcaccgtcttcaccgtcgacactgtc
ggtcgtaagccgatccagttcatgggcttcggtatcctcaccattcttttcgtggtcatg
ggtttcgcctacaagcacctctcgcctcacgcgctgctcgccattttcgtccttgcccag
ttcttcttcaactttggtcccaacgctaccacctttatcgtgcccggcgaggtgtttccc
actcgttacaggtctacctcgcacggcttgagcgccgccatgggcaagatcggctctatc
atcggtcagggcgccattgcgcccctgcgtaccaggggcgctgtcaagggaggaaaccca
aacccgtggatgaaccacgtgttggagatctatgctctcttcatgttgcttggtgttggt
accactttcttgattcccgaaacgaagcggaagacgctggaggagttgtcgggcgagttc
gatatgagtggtgaggaggaggcgcagagggatacgaccctcactgagcataagacggag
gcacccacgagtagtgctgctgtgaacgcttga

DBGET integrated database retrieval system