KEGG   Neurospora crassa: NCU08894Help
Entry
NCU08894          CDS       T01034                                 

Definition
(RefSeq) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
ncr  Neurospora crassa
Pathway
ncr00860  Porphyrin and chlorophyll metabolism
ncr00970  Aminoacyl-tRNA biosynthesis
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCU08894
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NCU08894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncr01007]
    NCU08894
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ncr03016]
    NCU08894
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ncr02048]
    NCU08894
Enzymes [BR:ncr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     NCU08894
Amino acid related enzymes [BR:ncr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NCU08894
Transfer RNA biogenesis [BR:ncr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NCU08894
 Prokaryotic Type
   Other AARSs
    NCU08894
Prokaryotic defense system [BR:ncr02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    NCU08894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 3874979
NCBI-ProteinID: XP_958832
UniProt: Q1K698
Position
Linkage Group V; V
AA seq 636 aa AA seqDB search
MKLDELKPLEALLTADFRQIEPRLQALDKHLILRTYLDGYTLGDIDTKIWLALRGNRAAV
SFIKRGSLANLARWFNYIEENHPEIQAEIKAKDAAAKAKVAAASKAGASYALALQNADQG
VVTRFLPEPSGYLHIGHAKAALLSDYFAHQAYKGQLRLRLDDTNPSKEKQEYQDAIIEDL
ALMGIKPDTVTYTSDYFDYLYDMCVRMIKEGHAYADDTDQDTMRDQRWKGIASARRDRSV
EENLRIFTEEMKNGTEEGLKNCIRAKLSVDNPNKALRDPVIYRCNIETPHHRTGTKWKMY
PMYDFACPVVDSHEGVTHALRSTEYTDRNPQYQWFIDTLKLRQVYMWDFARMNFIRTFLS
KRKLAKLVDTGKVWGWDDPRMPTIRGVRRRGMTIPALRDFILKQGPSRNVVTMDWTNFWA
SNKKEIDPIAPRHTAITKKDAVKVVVKGADAPAEPVKQEKPKHPKNKEVGTKQVTFANEL
IMDQADAKSFKDGEEITIMGWGNGFVRNIDTSAEVIPAFEIDLNLAGDVKSTEKKVTWLA
SKGQTLVPAELWDFDYLITKDVLQEEDNMEDFLNPVTETMEEAWCDEAAASLKKDDIIQL
ERRGYYRVDKGLNDWKEGEEKKLVLFCIPTGKTGSK
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggacgagctcaagcctctcgaggccctcctcaccgcggacttccgccagatc
gagccccgcctgcaggctctcgacaagcacctgatcctgcgcacctacctcgacggctac
accctcggcgacatcgacaccaagatctggctcgccctccgtggcaaccgcgccgccgtc
tccttcatcaagcgcggctcgctcgccaaccttgccagatggttcaactacattgaggag
aaccaccccgagatccaggccgagatcaaggccaaggatgctgccgccaaggccaaggtc
gccgccgcctccaaggccggtgccagctatgcgctcgccctccagaacgccgaccagggc
gtcgtcacccgtttccttcccgagccctcgggctacctgcacatcggacacgccaaggcg
gccctcctcagcgactactttgcccaccaggcctacaagggccagttgcgcctccgtctc
gacgacaccaacccttccaaggagaagcaggagtaccaggatgccatcatcgaggatctc
gccctcatgggcatcaagcccgacacggtcacctacacgtccgactacttcgactacctc
tacgacatgtgcgtgcgcatgatcaaggagggccacgcctacgccgatgacaccgaccag
gacaccatgcgcgaccagcgctggaagggtattgcctctgcccgccgcgaccgctccgtc
gaggagaacttgcgcatcttcaccgaggagatgaagaacggtaccgaggagggtctgaag
aactgcattcgcgccaagctgtccgtcgacaacccgaacaaggctctccgcgaccccgtc
atctaccgctgcaacatcgagaccccccaccaccgtaccggcaccaagtggaagatgtac
cccatgtacgacttcgcctgccccgtcgttgacagccacgagggcgtcacccacgctctc
cgctccaccgagtacaccgaccgcaacccccagtaccagtggttcattgataccctcaag
ctccgccaggtctacatgtgggatttcgcccgcatgaacttcatccgcaccttcctctcc
aagcgcaagctcgccaagctcgtcgataccggcaaggtctggggctgggacgaccctcgc
atgcccaccatccgtggtgtgcgcaggcgcggtatgaccatccccgctcttcgcgacttt
atcctcaagcagggcccctcccgcaacgtcgtcaccatggattggaccaacttctgggct
agcaacaagaaggagatcgaccccattgctccccgccacaccgccatcaccaagaaggac
gccgtcaaggtggtcgtcaagggcgccgatgcccccgccgagcccgtcaagcaggagaag
cccaagcaccccaagaacaaggaggtcggcaccaagcaggtcactttcgccaacgagctc
atcatggaccaggccgatgccaagtcgttcaaggacggcgaggagattaccattatgggt
tggggcaacggctttgtccgcaacattgacacctctgccgaggtcatccccgcctttgag
atcgatctcaaccttgccggcgatgtcaagtctaccgagaagaaggttacctggctcgcg
tccaagggccagacgctggtccctgccgagctctgggactttgactacctcatcaccaag
gacgttctccaggaggaggacaacatggaggacttcctcaaccctgtcaccgagaccatg
gaggaggcctggtgcgacgaggcggcggcctccctcaagaaggacgacatcattcagctc
gagagacgcggttactaccgggttgacaagggtctcaatgactggaaggagggcgaggag
aagaagctcgtgctgttttgcattcctactggcaagactggttccaagtaa

DBGET integrated database retrieval system