KEGG   Neurospora crassa: NCU09118Help
Entry
NCU09118          CDS       T01034                                 

Definition
(RefSeq) DNA topoisomerase I
  KO
K03163  DNA topoisomerase I [EC:5.99.1.2]
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ncr03032]
    NCU09118
DNA replication proteins [BR:ncr03032]
 Eukaryotic Type
  DNA Topoisomerases
   NCU09118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc
Motif
Other DBs
NCBI-GeneID: 3874180
NCBI-ProteinID: XP_011393241
UniProt: V5IPM9
Position
I
AA seq 893 aa AA seqDB search
MDAADSKVHMAPVGVSIRNGPVDQDRMDVDSSVSGQAKRKSRTSIDQSINYKDDSSDDEA
PLAKRSKTQHKQPDSDSDDEPIAKKNGARLPPSAKNTDMDVDSDDDEPLGKIAAKKANIE
KEAAKEAKSIRAGTKAKKPAAKKAVKDESSDDEPLAKPTKRQVNGTAAKKTNGVKKEESD
SDVPIAKRAKKAPAAKPAAKPAAKPAAKAATKAAPKGKVAAVKKSVKEESKDITDEDDEE
EEYKWWEESAKKEDDSIKWTTLEHNGVIFPEDYQRLPKDVKLLYDGTPVELDIEAEEAAT
FFGFMLNSTVNVENPTFQKNFFRDFKEILDRTGGAKDKNGKKVDIKEFEKLDFSQLWAYK
DAQTKAKNARSSAEKKAEKAERDKRDAPYLYCKWDGRKEKVGNPRVEIPGLFRGRGDHPK
TGCIKKRVLPEQITINIGKEAKVPEPPAGHKWKAVQHDNKATWLAMWQENINGHYKYVML
AANSTVKGKADFKKFEKARELKKYIDRIRADYTKDLKSEVMADRQRATAMYLIDKFALRA
GNEKDTENEAETVGCCSLKYEHVTLREPNTVIFDFLGKDSIRFYNEFTVDRQVFKNLKMF
KKPPKEDGDDIFDRLTTTQLNKHLSSYMPGLTAKVFRTYNASYTMSKLLQELKVTNATVH
EKVKLYNDCNRQVAILCNHKRTVGASHEQQMKKLVEQIKGLRYQKWRTKMMMLDLDPKLK
KKKGAAYFELDEDLTEEWVKSHQEFLVEDQKAKINKKFEKDNEKRIADGEKPLPASELKE
RLKAASELEAKFKKENKTKKVEAEGKGPSVEKLEAALEKLDQRIKNLELQSADREGNKEV
ALGTSKINYIDPRLTVVFSAKFNVPIEKFFSKTLREKFKWAIESVGNDSTWEF
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgctgattccaaggttcacatggctcccgttggtgtctccatccgtaatggc
cccgtcgaccaggacaggatggacgtcgactcctcagtaagcggtcaggctaagcgcaaa
tcgcggacatccattgatcagtccatcaactataaggatgactccagtgatgacgaagca
cccttggcgaaacgttcaaaaacacaacataagcaaccagactccgatagcgacgacgag
ccgattgcgaaaaaaaatggcgcgagattgcctccctccgccaagaatacggatatggac
gtagattctgatgacgacgaacctctcggaaagatcgccgcgaagaaggccaatatcgag
aaggaagccgccaaggaagccaagagtattcgtgctggtaccaaggccaagaagcctgct
gctaagaaggccgtcaaggatgaatcctccgatgacgaaccccttgcgaaacccaccaag
cgacaggtcaacggcacagctgcgaagaagacgaatggtgtgaagaaggaagagtctgac
tcggatgtgcccatcgctaagcgggcgaagaaggcacctgccgcgaagcctgctgcaaag
cctgctgcaaagccggctgcaaaggctgccacgaaggccgccccgaagggcaaggttgcc
gctgtcaagaagtccgtcaaggaggaatcgaaggacatcaccgatgaggacgatgaggaa
gaggagtataagtggtgggaggagtcggcaaagaaggaagatgacagtatcaagtggacc
accttggagcacaacggcgtcatcttccccgaggattaccagcgtttgcccaaggacgtc
aaactgctctacgatggaacgccggtcgaactcgatatcgaggccgaggaagctgcgacc
tttttcggcttcatgcttaactcgacggtgaatgttgagaacccaactttccagaagaac
ttcttcagggacttcaaggagatcctagatcggacaggtggcgccaaggacaagaatggc
aaaaaggttgacatcaaggaattcgaaaaactcgacttctcccagttgtgggcttacaaa
gatgctcaaacgaaggctaagaatgcccggtcgtcagcagagaagaaggccgagaaagcc
gaaagggacaagagggacgccccctatctatattgcaagtgggatgggcgaaaagaaaag
gttggtaaccccagagtggaaattccaggacttttccgtggtcgcggtgatcaccccaag
accgggtgtatcaagaagcgtgttttgccagagcaaattaccatcaacatcggcaaagag
gccaaggtcccagagccgccagctggccacaagtggaaggccgttcaacatgacaacaag
gcaacttggctcgcgatgtggcaagagaacatcaacggacactacaagtatgtgatgttg
gcagcaaacagtactgtgaagggcaaggccgatttcaagaagttcgaaaaggcccgtgag
ctcaagaaatacattgatcgcatccgtgccgattataccaaggacctcaagagcgaggtc
atggctgacaggcaacgcgcaacggccatgtacctcattgacaagttcgctctcagagcc
ggtaacgaaaaggataccgagaacgaggccgagactgtcggttgctgctctctcaagtac
gagcacgtcaccctcagggaacccaacactgtcattttcgacttcttgggcaaggacagt
attcgtttctacaacgagttcacggtcgatcgccaggtcttcaagaacctcaaaatgttc
aagaagcctcccaaggaggacggagatgacatctttgacagactgacgacaacccaactc
aacaagcacttgtcgagctacatgcctgggctcacggcaaaggttttccgtacttacaac
gcatcgtacaccatgtccaagctgctgcaggagctcaaggtgacgaatgccacggtacat
gaaaaggtcaagctctacaatgactgcaaccgccaagttgctattctttgcaaccataag
cgtactgtcggtgctagccatgagcagcaaatgaagaaacttgtcgagcagatcaagggt
ttgcgataccagaaatggcggacaaagatgatgatgctcgaccttgatcccaagctcaag
aagaagaagggtgctgcctactttgagcttgatgaggacttgacagaggagtgggtcaag
tctcatcaggagttcctcgttgaggaccagaaggccaagatcaacaagaagttcgaaaag
gacaatgagaagcggatagctgatggcgagaagcctctgcctgccagcgagctcaaggag
cgactcaaggcggcatccgagctagaagccaagttcaagaaggagaacaagaccaagaag
gtcgaggctgaaggcaagggtccttctgtcgagaagctggaggcagctcttgagaagctt
gatcaacgtatcaagaacctggagctccagtccgcggatcgtgaaggaaacaaagaggtt
gctcttggcacttccaaaattaactacattgatccccgtcttaccgtcgtcttctcggcc
aagtttaatgtgcctatcgagaagttcttctccaagacgttgcgcgaaaagttcaagtgg
gctatcgagtctgtcggaaacgactcgacgtgggagttctga

DBGET integrated database retrieval system