KEGG   Neurospora crassa: NCU09390Help
Entry
NCU09390          CDS       T01034                                 

Gene name
tnr-1
Definition
(RefSeq) tetrahydroxynaphthalene reductase-1
  KO
K17739  tetrahydroxynaphthalene reductase [EC:1.1.1.252]
Organism
ncr  Neurospora crassa
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCU09390 (tnr-1)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.252  tetrahydroxynaphthalene reductase
     NCU09390 (tnr-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR ADH_zinc_N Polysacc_synt_2 B12-binding DUF1372 Epimerase
Motif
Other DBs
NCBI-GeneID: 3874895
NCBI-ProteinID: XP_011395292
UniProt: V5IKV7
Position
Linkage Group VII; VII
AA seq 331 aa AA seqDB search
MALPAFLARLLSHFSSNKASTTEKKVRVASNSSSTTTSSIQATPNPAANMPGVTAPSGTS
KYDQIPGPLGIQSAHLGGKVALVTGAGRGIGREMALELGRRGAKVVVNYANSDISANEVV
QAIKKIGSDAVAIKANVSDVSQIERLFREAKQRFGKLDIVCSNSGVVSFGHIKDVTPEEY
DRVFNINTRGQFFVAREAYKNLEVGGRLILMGSITGQAKAVPKHTVYSASKGAIETFVRC
MAIDFGDKKITVNAVAPGGIKTDMYHAVCREYIPGGDKLDNQGVDEYAAGWSPLHRVGLP
IDIARVACFLASQDGEWINGKVIGVDGGACM
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccctccctgcttttctcgcccgtctcctgtcccacttctcgtctaacaaagccagc
accacagagaagaaagtacgagtcgcctctaacagctcaagcacgactacttccagcatc
caagccactccaaatccagccgccaacatgcccggtgtcacagccccgtccggtactagc
aagtatgaccagatccccggtcccctcggtatccagtctgcccatcttggtggcaaggtg
gcgcttgtaaccggtgccggccgcggtatcgggagggaaatggcgctcgagcttggacgt
cgtggagccaaggtggtagtcaactacgccaacagcgacatctcggccaacgaggtcgtg
caggccatcaagaagatcggctccgacgcggtcgccatcaaggccaacgtcagcgatgtc
agtcagattgagaggctcttccgcgaggccaagcagaggttcggcaagctcgacattgtg
tgctccaattcgggtgtcgtctcgttcggtcacatcaaggacgtcaccccggaggagtac
gaccgcgtcttcaacatcaacacccgtggccagttctttgttgcgcgcgaggcctacaaa
aaccttgaggttggcggccgcttgatcctcatgggatccatcacgggccaggccaaggcc
gttcccaagcacacagtttactctgctagcaagggagccattgagacttttgtccgctgc
atggctatcgactttggagacaagaagattaccgtcaacgccgtcgctccgggcggtatc
aagacggacatgtaccacgccgtgtgcagggagtacatccccggcggcgacaagctcgac
aaccagggtgtggacgagtatgccgctgggtggtcgcctcttcaccgcgtgggtctcccc
atcgacattgctcgtgttgcctgcttcctagcttcccaggatggcgagtggatcaatggt
aaggttatcggcgttgatggcggcgcctgcatgtaa

DBGET integrated database retrieval system