KEGG   Neurospora crassa: NCU09534Help
Entry
NCU09534          CDS       T01034                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ncr  Neurospora crassa
Pathway
ncr00480  Glutathione metabolism
ncr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NCU09534
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU09534
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCU09534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx DUF4174 AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 3874066
NCBI-ProteinID: XP_957919
UniProt: Q7S060
Position
Linkage Group V; V
AA seq 229 aa AA seqDB search
MIPRYHHRSVATLARTSLTTRHLKLSPILPQQQQQQPRLPVSKPAFRCQPAISRRFATTT
LNMSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEK
YPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKN
EKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELGE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgataccccgctaccatcatcgctcagtagctacacttgctcgcacctcactcaccact
cgtcatttgaaactatcaccgattctacctcaacaacaacaacaacaacctcgactgcca
gtttccaaaccagcattccgttgccagccagccatttccagacgcttcgcaacaaccaca
cttaacatgtcttctgccactactatctacgactttaagccccttgacaagaagggctcc
gaactccccctctccacctaccaaggcaaggtagtcctgatcgtcaacgttgcctccaaa
tgcggtttcacgcctcaatacgccggcctggaaaaggtctacaaggagatcaaggagaag
tacccggacgattttgagatcctcgctttcccttgcaaccagttcggcggacaggagccg
ggcaccgaggaggagatccagtcgttctgccagctcaactatggcgtttccttccccatc
atgaagaaggtggaggtcaacggcgacaatgctgatcccctctatgaatggatgaagaat
gagaagcctggcctgatgggattgaagagaatcaagtggaactttgaaaagttcttgatt
ggaaaggatggaaaggtcaagggacggtgggcgagcactacgaagcctgagtctctgaag
gaggctatccttaaggagttgggcgagtaa

DBGET integrated database retrieval system