KEGG   Neurospora crassa: NCU09873Help
Entry
NCU09873          CDS       T01034                                 

Gene name
acu-6
Definition
(RefSeq) acetate utilization-6
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ncr  Neurospora crassa
Pathway
ncr00010  Glycolysis / Gluconeogenesis
ncr00020  Citrate cycle (TCA cycle)
ncr00620  Pyruvate metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
Module
ncr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU09873 (acu-6)
   00020 Citrate cycle (TCA cycle)
    NCU09873 (acu-6)
   00620 Pyruvate metabolism
    NCU09873 (acu-6)
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NCU09873 (acu-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33
Motif
Other DBs
NCBI-GeneID: 3876302
NCBI-ProteinID: XP_960155
UniProt: Q7RVS9
Position
Linkage Group VI; VI
AA seq 605 aa AA seqDB search
MGDPVIRTASPYTNPIIKCPRLQRLSSGPSSSFINNNNSNNNNNKSSNMFNHDHVNKTNL
HPGGVKPHVEHTELEEELHQKAHIDYDRVAIIANPSVASLYEDALVYETGTAITSSGALT
AYSGKKTGRSPSDKRIVKEPSSENDIWWGPVNKPMSPEVWKINRERAVDYLNTRNRIYVV
DGYAGWDEKYRIRVRVVCARAYHALFMRNMLIRPPREELEHFHPDYTIYNAGSFPANRYT
EGMSSSTSVAINFAEKEMVILGTEYAGEMKKGIFTVMFYEGPVKHNILTLHSSANEGKDG
DVTLFFGLSGTGKTTLSADPNRRLIGDDEHCWSDRGVFNIEGGCYAKTIGLSAEKEPDIF
NAIRYGSVLENVVFNPETREVDYGDATLTENTRCAYPIEYIPNAKIPCLSPNHPKNIILL
TCDARGVLPPISKLDSAQTMFHFISGYTSKMAGTEDGILEPQATFSSCFAQPFLALHPMR
YAKMLAEKIENHNANAWLLNTGWVGAGFAQGGKRCPLKYTRAILDAIHSGELANVEYENY
EVFNLQVPKSCPGVPSELLNPKTAWTAGANSFDTEVKKLGGLFLENFKKYESEATEDVIK
AGPVV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccccgtcatcagaaccgcttctccctacactaatcccatcatcaaatgccct
cgactacaacgtctctcgtctggtccatcttctagcttcatcaacaacaacaacagcaac
aacaacaacaataaatcatccaacatgttcaaccacgatcacgtcaacaagaccaacctc
caccctggtggtgtcaagccccatgtcgagcacacagaactagaggaggagctccatcaa
aaagctcacatcgactatgacagagtcgctattatcgccaacccttcagtcgcctccctc
tacgaagatgcccttgtctatgagacgggcactgccatcacatccagcggtgctcttacc
gcctactcgggcaagaagactggccgttctccctcagataagcgtatcgtcaaggagcct
tcatcagaaaacgacatttggtggggacctgtcaacaagcccatgagcccagaggtctgg
aagatcaaccgcgagcgtgctgtcgactacctcaacaccaggaatcgcatctacgtcgtt
gacggttatgccggctgggatgagaagtaccgcatccgcgtccgtgtcgtctgcgcccgc
gcctaccatgctctcttcatgcgcaacatgcttatccgccctccccgtgaggagctcgag
cacttccaccccgactacaccatctacaatgccggctctttccccgccaaccgttacact
gagggcatgtcctcctccacctccgttgccatcaactttgccgagaaggagatggtcatc
cttggtaccgagtacgccggtgagatgaagaagggtatcttcaccgtcatgttctacgag
ggccccgtcaagcacaacatcctcactctccactcctccgccaacgaaggcaaggatggc
gacgtcactctcttcttcggtctttccggaactggcaagaccaccctctcggccgacccc
aaccgccgcctcattggtgacgacgagcactgctggtccgaccgcggtgtcttcaacatc
gagggtggctgctacgccaagaccattggtctctccgccgagaaggaacccgatattttc
aacgccatccgctacggttccgtcctcgagaacgttgtcttcaaccccgaaacccgcgag
gtcgactacggtgacgccaccctcaccgagaacacccgctgcgcctatcccatcgagtac
atccccaacgccaagatcccctgcctgtcgcccaaccaccccaagaacatcatcctcctc
acttgcgacgcccgcggcgtgctccctcccatctccaagctcgactcggcccagaccatg
ttccactttatctccggctacacctccaagatggccggtaccgaggacggcattcttgag
ccccaggcgaccttctcttcgtgcttcgcccagcccttcctggccctgcaccccatgcgc
tacgccaagatgctcgccgagaagatcgagaaccacaacgccaacgcttggctcctcaac
accggctgggtcggtgccggcttcgcccagggcggcaagcgctgcccgctcaagtacacc
cgcgccatcctcgacgccatccactctggcgagctcgccaacgtcgagtacgagaactac
gaggtcttcaacctccaggttcccaagagctgccccggtgttccctcggagcttctcaac
cccaagaccgcctggaccgctggtgccaactcgttcgacaccgaggtcaagaagctcggt
ggtctcttcctcgagaacttcaagaagtacgagagcgaggctactgaggatgtcatcaag
gctggccccgttgtttaa

DBGET integrated database retrieval system