KEGG   Neurospora crassa: NCU10106Help
Entry
NCU10106          CDS       T01034                                 

Definition
(RefSeq) mitochondrial triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00010  Glycolysis / Gluconeogenesis
ncr00051  Fructose and mannose metabolism
ncr00562  Inositol phosphate metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
ncr01230  Biosynthesis of amino acids
Module
ncr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncr_M00002  Glycolysis, core module involving three-carbon compounds
ncr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU10106
   00051 Fructose and mannose metabolism
    NCU10106
   00562 Inositol phosphate metabolism
    NCU10106
Enzymes [BR:ncr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCU10106
Exosome [BR:ncr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCU10106
  Exosomal proteins of bladder cancer cells
   NCU10106
  Exosomal proteins of melanoma cells
   NCU10106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5847945
NCBI-ProteinID: XP_001728539
UniProt: A7UWK5
Position
Linkage Group IV; IV
AA seq 300 aa AA seqDB search
MSSASPSRERRRLVGVSTKMYFSHARTTNFITSFLDLMQHHTSTKTEQSNDNRNNLAAAL
ASKIDIFIIPDHLSLQSAINRTANHPSQSGPTDPKILFGAQNCHWEDSGPFTGEVSPAVL
AEVGCSIVELNHAERRRHFAETDAITCLKAQAVIRNGMIPLICVGEGSPGQIPALSEVAI
MKAAAEVVDQVELCLEGVDPTKEVWLAYEPVWAIGAKEPAGVEHVRGVVRTIRKSEVVRG
REERGGVTRILYGGSAGPGLFGQLKEVDGVDGLFLGRFAHEEGQFWKTICEVAEVEWEGR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgcatcaccttcccgtgagcgccggcgtctagtaggcgtctcaacaaaaatg
tacttctcccacgcccgcaccaccaacttcatcacctccttcctcgacctcatgcaacac
cacacctccaccaaaaccgagcagtccaacgacaacagaaacaacctggctgccgccctc
gcctccaagattgacatattcatcatccccgaccacctctctttgcagtctgccatcaac
cgcaccgccaaccacccaagtcaatctggcccaactgatcccaaaatcctcttcggcgcg
caaaactgccactgggaagattccggtccgttcacaggcgaggtatctcccgccgtcctg
gccgaggtagggtgcagcatagttgaactcaaccacgctgaacggcgccgccactttgcc
gaaacagatgccatcacctgcctcaaagctcaggcagtcatacgaaacgggatgatcccc
ctcatctgcgttggcgaaggctcccctggtcaaatacctgccttgagcgaggtagcaatc
atgaaagcggcggcggaggtggtcgaccaagtagaactttgcctagagggcgttgacccc
acaaaagaagtttggctggcttacgaacctgtttgggctattggtgcaaaggagcctgcg
ggggtggaacatgtgaggggggtggtgaggactatacgaaaaagtgaggtggtgaggggg
agggaggaaaggggcggggtgacgaggattttgtatggagggagcgcggggccggggttg
tttggacaactgaaagaggttgatggagtagatgggttgtttttggggaggtttgcgcat
gaggaggggcagttttggaagacgatttgtgaggttgctgaggtcgagtgggaagggagg
tga

DBGET integrated database retrieval system