KEGG   Naumovozyma castellii: NCAS_0A00540Help
Entry
NCAS_0A00540      CDS       T02233                                 

Gene name
NCAS0A00540
Definition
(RefSeq) hypothetical protein
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00270  Cysteine and methionine metabolism
ncs00920  Sulfur metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NCAS_0A00540 (NCAS0A00540)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NCAS_0A00540 (NCAS0A00540)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     NCAS_0A00540 (NCAS0A00540)
    2.3.1.46  homoserine O-succinyltransferase
     NCAS_0A00540 (NCAS0A00540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 11526832
NCBI-ProteinID: XP_003673005
UniProt: G0V578
Position
1:90373..91803
Genome map
AA seq 476 aa AA seqDB search
MTFNLRKLDVEEIKRENPFTKLVQGQTIVEIPSLQLESGLTINNFPIAYKTWGTLNEKRD
NVLVICHALTGSADVADWWGPLLGDNLAFDPSRFFIICLNSMGSPYGSFSPLSINEETNE
RYGPEFPLCTVRDDVRAHKIVLDSLGVSSIACVIGGSMGGMLALEWTVMYGKDYVRNLVA
LATSARHSAWCISWSEAQRQSIYSDPKYQDGFYPLEDPPLAGLSAARMAALLTYRSRNSF
ESKFARRTPSLLQQQKAQRVESRPASTVNEKSIQIHNDGYVGRCRPLVVDRQSSVSSSES
LHSVSSVTSLSSVSGEVKELNPAQTFFSAQSYLRYQGTKFVNRFDANCYIAITRKLDTHD
LARDRVEYEDDLSEVLEVVQQPTLVIGISSDGLFTYSEQEFLAEHIPNSHLEKIESPEGH
DAFLLEFKLINEMIVNFLKKNAKEITDSEPRPWGTDSINNGLKDSVFGEAEEVTNW
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaatttaaggaaattagacgtcgaagagattaagagggaaaaccctttcaca
aaactggtccagggccaaactattgttgaaattccctcattacaactagaatcaggctta
acgataaacaacttccccatcgcatacaagacatgggggacactaaatgagaaacgtgat
aacgttctagtgatttgtcatgcattaaccgggtctgctgacgttgctgattggtgggga
ccgctactaggtgataatttagcctttgatccttccagatttttcatcatttgtttgaat
tccatggggtcaccatacggttccttttcacctttgtctataaatgaggagaccaatgag
agatacggtccagaattcccattatgtactgtacgtgatgatgtgagagcacataagatt
gtccttgattcattaggcgtaagttctatagcttgtgtcattggtgggtccatgggtggt
atgctcgccttagaatggaccgtcatgtatggcaaggattacgtgagaaacttggtggca
ttggctacatcagcaagacattccgcatggtgtatttcatggtctgaagcacaaagacaa
tctatttactcagatcctaaataccaggatgggttttatcccttggaggatccgccatta
gctggtttatctgctgctcgtatggctgcactattaacttatcgttcgagaaacagtttt
gaaagtaaatttgctagaagaactccatcattattacaacaacaaaaggctcaaagagtg
gaaagtcgtccggcttccacagttaatgaaaaatctattcaaatacataatgatggttat
gttggtagatgtcgcccacttgttgtagatcgtcaaagcagcgtatcatcatctgaatcg
ttacattctgtgtcctctgtcacttcattgagttccgtatcaggtgaagtgaaagagttg
aacccagctcagacattcttctctgcacaaagttatcttcgttaccaaggtaccaaattt
gttaacagatttgatgccaattgttacattgctattacaaggaaattagatactcatgat
ttagcccgtgatagagtagaatatgaggatgatctttctgaagtgctagaagttgttcaa
caaccaacattagtcattggtattagttcagatggattattcacgtactcagaacaagaa
tttttagctgaacatataccaaatagtcatttggagaaaattgaatctccagagggtcat
gatgcattcttattagaattcaaattaataaatgaaatgatcgttaattttttgaagaaa
aatgccaaggaaataacagatagcgaacctcgcccatggggaaccgactctataaataat
gggttaaaagattcagtatttggagaagccgaagaggtaactaattggtaa

DBGET integrated database retrieval system