KEGG   Naumovozyma castellii: NCAS_0A02730Help
Entry
NCAS_0A02730      CDS       T02233                                 

Gene name
NCAS0A02730
Definition
(RefSeq) hypothetical protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
ncs  Naumovozyma castellii
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncs01009]
    NCAS_0A02730 (NCAS0A02730)
Protein phosphatases and associated proteins [BR:ncs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCAS_0A02730 (NCAS0A02730)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 2H-phosphodiest
Motif
Other DBs
NCBI-GeneID: 11529065
NCBI-ProteinID: XP_003673222
UniProt: G0V5U3
Position
1:522320..523381
Genome map
AA seq 353 aa AA seqDB search
MTDNHDSPKDTQEEVTPGMEMSPITNTSESLKGMQITEDPHPDFLTADADLTTDLPDDTE
VIDLIHLKITSLEALNLYRFKKLTALCLRQNLIESITEVEVLPYDTFIDLDLYDNRIKHI
SSNVNKLVHLKNLDLSFNKIKNIKNIDKLYELENLYFVQNKISKIENLSTLKKLKNLELG
GNRIQALEPHAFDGLENLQELWLGKNAIPKLINLNPLKNLKILSIQANRLKKIEGLEELT
NLEELYVSNNFLTKIEGLENNKKLTMLDITSNRITKIENVSHLTELTDLWCSFNQVDQSF
QSLGEELGGLTKFETIYLEGNPIQLNNETAYRRKLMLSLGPSLQKIDATFIRG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaccacgactcccccaaagacacccaggaagaagtaacccctggcatggaa
atgtcacctatcaccaacacatcggaatccctcaagggaatgcaaatcacggaggaccca
catccagatttccttaccgctgatgctgatctaactaccgacttgccagacgacacagag
gtgattgacttgatccatttgaagattacatcgttagaagccttgaatttgtacagattc
aagaaactgactgctctttgtctgagacagaacctcattgaaagtatcaccgaggtggaa
gtgctaccatatgataccttcattgatttggatctttacgataatcgtatcaagcatatc
tcgagtaatgtaaataagttggttcatttgaagaatttggatctatctttcaataagatt
aaaaatattaagaatatagataaattatatgaattggaaaatctatattttgttcagaat
aagatttctaagatcgagaatctatctactttaaagaaattgaagaacttggaattagga
ggaaacagaatacaagcattggagcctcatgcatttgatggattggaaaatttacaagag
ctatggttgggtaaaaatgctatccctaaattgattaatttgaatccattgaagaactta
aagatcttatctattcaagccaataggttgaaaaagattgaaggtttggaagagttaacc
aatctggaagaattatacgtctccaataacttcctaactaaaattgaaggactggaaaat
aataagaaattaacaatgttagatatcacttcgaacagaattacaaagattgaaaatgtc
agtcatttgactgaattaactgatctttggtgttcattcaatcaagtcgatcaatcattc
caatctttaggggaagaattgggtgggctaacgaaatttgaaactatctacctagaaggg
aacccaattcaattaaacaatgaaactgcgtatagaagaaaactgatgttaagtttgggc
ccatcactccagaagattgatgcaacctttattcgtggttaa

DBGET integrated database retrieval system