KEGG   Naumovozyma castellii: NCAS_0A03160Help
Entry
NCAS_0A03160      CDS       T02233                                 

Gene name
NCAS0A03160
Definition
(RefSeq) hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00020  Citrate cycle (TCA cycle)
ncs00620  Pyruvate metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0A03160 (NCAS0A03160)
   00020 Citrate cycle (TCA cycle)
    NCAS_0A03160 (NCAS0A03160)
   00620 Pyruvate metabolism
    NCAS_0A03160 (NCAS0A03160)
Enzymes [BR:ncs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NCAS_0A03160 (NCAS0A03160)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP SelA AAA_33 ATPase
Motif
Other DBs
NCBI-GeneID: 11524740
NCBI-ProteinID: XP_003673264
UniProt: G0V5Y5
Position
1:complement(619303..620961)
Genome map
AA seq 552 aa AA seqDB search
MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS
SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD
HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF
PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA
NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA
EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH
PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF
LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA
KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR
ATPDVLAAGPQI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaattaaagtctcatcgtcgaaaccaatcgacatctcagactcgcaaatcgtc
gagcaaagcattagaaaggaactaggtcttagcgaagacgtcactaccattagacgtaac
gcaccagctgctgttctttacgaagatgctctacatgaacgtaagaccgtcatcgcctct
tctggtgcattgattgcttattccggtagcaagactggtagatctccacgtgataaacgt
atcgtggaggaggaaacatcaaaggataacgtttggtggggtcccgttaacaaaccatgt
tctgaaaagacttggaccatcaatagagaaagagccgctgattatttaagaacaagagat
catttatacatcgtggatgcattcgcaggttgggatccaaaatatagaattaaagttcgt
gtcgtgtgtgcaagagcttaccatgccatctttatgacaaatatgttaattagaccaact
caagaagaattagccacttttggtgaacctgatttcaccatttggaatgctggtcaattc
cctgctaataagaatactcaagatatgtcctcaaagactaccattgaaattaattttaaa
gccatggaaatgattattcttggtactgaatatgctggtgaaatgaaaaaggggatcttt
accgtcatgttttacttaatgccagtttatcataatattttaactttgcattcttcagct
aatcaaggtattcaaaatggtgacgttactttattctttggtttaagtggtactggtaag
acaaccctttctgctgatccacatagattattaatcggtgatgacgaacattgttggtcc
gataccggggtctttaacattgaaggtggttgttacgctaaatgtattaatttatctgct
gaaaaggaacctgaaatctttaatgccattaaatacggttccatcttggaaaatgtcatt
tatgataagaatactcgtgttgtcgattatgatgatacttccatcactgaaaatacaaga
tgtgcttacccaattgaatacattccaagtgccaagattccatgtttagctgattctcat
cccaaaaatattatcctattgacttgtgatgcttctggtgtcttaccaccagtttccaaa
ttgactccagaacaagttatgtaccatttcatttctggttatacttcaaagatggctggt
acagaagaaggtgtcactgaaccagaatctactttctcttcatgttttggtcaaccattc
ttggctttgcatccaatcagatacgcaacaatgttagctgaaaagatttcacatcattct
gctgatgcttggttaattaacactggttggactggttcttcttacgttaatggtggtaaa
cgttgtccattgaagtacacaagagccatcttggattccattcatgacggatctttagca
aagcaatcttatgaaactttaccaatcttcaacttgagtgttccaactgctgttaatggt
gttccaaaggaaatattaaacccagcaaagaactggtctgaaggtgaagctaagtacagt
accgctgttagcaaattgggttcattattcgttgaaaactttaagacttatcaagatagg
gctactccagatgtcttagctgctggtccacaaatatag

DBGET integrated database retrieval system