KEGG   Naumovozyma castellii: NCAS_0A07670Help
Entry
NCAS_0A07670      CDS       T02233                                 

Gene name
NCAS0A07670
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCAS_0A07670 (NCAS0A07670)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NCAS_0A07670 (NCAS0A07670)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NCAS_0A07670 (NCAS0A07670)
    1.1.1.-  
     NCAS_0A07670 (NCAS0A07670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 Pyr_redox_3 ADH_zinc_N_2 DAO Pyr_redox Shikimate_DH Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 11526896
NCBI-ProteinID: XP_003673706
UniProt: G0V777
Position
1:complement(1527273..1528592)
Genome map
AA seq 439 aa AA seqDB search
MHSHSLSFLLSFPSKTLSNKQTNKTNNTKQNYLTTQHNIMRALAYFGKNDIKFTNDLPEP
TISAPDEMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCHEISGEGLPQAMGHEIAGTIIE
CGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKGLYNICSNLGLVGAGV
QSGGFAERLVMNERQCYKVPDHMSMDVAALIQPIAVSWHAVRVSKFKKGASVLIVGAGPI
GLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGDG
FDYAFDCSGNPATLKAAIECLTFRGTAVNVAIWGNKPVNFLPMDLTYQEKSYTGSMCYTF
HDFEAVINAFEKKLIDVEKARHMITGKVPIENGVKDAILRLITHKEQTIKIILTPNNHGE
LGEEPEQKKKRSFKGKTLK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcattcccattctctttctttccttctctccttcccttctaagaccctatcaaacaaa
caaacaaacaaaacaaacaacacaaaacaaaactacttaacaacacaacataatattatg
agagctctagcgtacttcggcaagaatgatatcaaattcacaaacgacctcccagaacca
accatttctgctcccgatgaaatgatcatcgacgtctcctggtgtggtatctgcgggacc
gatcttcacgaattccaagacggccccatctttttccctcacgacggctgctgccatgaa
atctccggggaaggtttacctcaagccatgggtcatgaaatcgctggtaccattattgaa
tgtgggccgggcgtcaccaaatttaaagtgggcgacagagtcgtggtggaacccacgggt
acttgtaaggataggtaccgttggcccaattcccccaatgtggacaaagaaccttgtgcc
gcatgtaagaagggtctatataacatttgttcaaatttgggactcgttggtgcaggtgtg
caatccggtgggtttgctgaaagattggtcatgaatgaaagacaatgttataaagttcca
gatcatatgtccatggatgtagctgctttgattcaacctattgccgtgtcatggcatgcg
gttcgtgtttccaaatttaagaagggtgcatcggtacttattgttggtgcaggacccatt
ggtttgggaactattttggctttgaatggtcatggtgtgagtgaagtggtggtttctgaa
cctgctaagattagaagagatttcgctgagaagatgggtgctattgtttatgacccttcc
gctaaggaccatgatgaatccattaaatatttgagatccattgccccaggtggtgatggg
ttcgactatgcatttgattgttctgggaatccagctactttgaaagccgctattgagtgt
ctgacatttagaggtactgctgtcaatgtggccatttggggtaataagcctgttaatttc
ttaccaatggatttaacttaccaagaaaagagttatactggttccatgtgttacactttc
cacgattttgaagctgtcattaacgcattcgaaaaaaaattaattgacgtggaaaaggca
agacatatgatcacgggtaaagtaccgattgaaaatggtgttaaggacgctatcttaagg
ttgattacacataaggaacaaactattaagatcattctaactccaaataatcatggtgaa
ttgggtgaagaaccagaacagaaaaaaaaaaggtcatttaagggcaaaactttaaaatga

DBGET integrated database retrieval system