KEGG   Naumovozyma castellii: NCAS_0A07780Help
Entry
NCAS_0A07780      CDS       T02233                                 

Gene name
NCAS0A07780
Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00071  Fatty acid degradation
ncs00350  Tyrosine metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0A07780 (NCAS0A07780)
  Lipid metabolism
   00071 Fatty acid degradation
    NCAS_0A07780 (NCAS0A07780)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCAS_0A07780 (NCAS0A07780)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCAS_0A07780 (NCAS0A07780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 BKACE Epimerase Copper-fist DUF2493
Motif
Other DBs
NCBI-GeneID: 11526847
NCBI-ProteinID: XP_003673717
UniProt: G0V788
Position
1:1548197..1549318
Genome map
AA seq 373 aa AA seqDB search
MLRFTNTRTLQQTSLMKSFLRLQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEIL
INVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLN
GSCMSCELCESGHESNCEHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCA
GITVYKALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMGYRVIGIDGGPGKEELFKSLG
GEIFVDFTKTKDIVAEIQEATRGGPQGVINVSVSEAAISLSTKYVRPTGTVVLVGLPAHS
YVKSEVFSHVVKSINIKGSYVGNRADTREALDFFARGLIKSPIKIIGLSELPNVYKLMEE
GKILGRYVVDTSK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttacaaatacaagaactttgcaacaaacttctctcatgaaaagtttccta
agactgcaatccacagttaccattcccaagatgcaaaaaggtgtgatcttctacgagaca
ggtggccccctacactacaaggacatccctgtccccaaaccaaaggctaacgaaattctg
atcaacgtcaaatattcaggtgtctgtcatacggatttgcacgcttggaagggggactgg
ccattagctactaaattacctctagttggtggtcatgaagggtctggtgaagtggtggcc
atgggggagaacgtgaagggatggaagattggggatttggccgggatcaaatggttgaat
gggtcttgtatgtcttgtgaattatgtgaatcaggtcatgaatccaactgtgaacatgct
gatttgtccgggtacactcatgatgggtcattccaacagtatgccactgcggatgccgtg
caggctgctagaattcctaagggaaccaatatggctgaagtagcacctatcttgtgtgct
ggtatcacagtttataaggctttgaaagaagctgacatgagagctgggcaatgggtttgt
atctccggagctgcaggtgggttagggtccctagcagttcaatatgctaaggctatgggt
tacagagtcattggtattgatggcggtccaggcaaggaagaattgttcaaatctcttggt
ggagaaatctttgttgatttcaccaagaccaaggatatcgttgccgaaattcaagaagcc
actagaggtggtccacaaggtgtcattaacgtctctgtctcagaggctgccatctctttg
tccactaagtatgtgagacccaccggtaccgttgttcttgttgggttaccagctcattct
tacgtcaagtctgaagtgttctctcacgttgttaaatccatcaatattaagggttcctac
gtcggtaacagagcagacactagagaagctctagatttttttgccagaggattaataaaa
tccccaattaagatcattggtctatccgaattgccaaacgtctacaagctaatggaggaa
ggtaaaatcttgggtagatacgttgtggacaccagtaaatag

DBGET integrated database retrieval system