KEGG   Naumovozyma castellii: NCAS_0A08000Help
Entry
NCAS_0A08000      CDS       T02233                                 

Gene name
NCAS0A08000
Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00500  Starch and sucrose metabolism
ncs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0A08000 (NCAS0A08000)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     NCAS_0A08000 (NCAS0A08000)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 11526741
NCBI-ProteinID: XP_003673739
UniProt: G0V7B0
Position
1:1582334..1584016
Genome map
AA seq 560 aa AA seqDB search
MKFIYTLLFITITYITQTIHALSASELSHLKLKIRNVSAPTTSSLIEDHIKGITIGGWLV
TEPYITPSLYNNATSMNRGNISIVDEYTLCFALGYNKSLSILSEHFETWITEDDFQEISE
SGFNLVRLPIGYWAWKVDHASGLYVENITYSDPYVSEGLQLGYLKKAIGWAEKYGLKVWI
DLHGLPGSQNGFDNSGERILRSNLGWLNEAHTKKLTLAIWSKMFKEFIGYSDSIVGMEIV
NEPLSTKIGIDDITEAYYEAFDLFKFRQRKSNDSVVADNMTFVIHDAFEPIGYWNLQFNP
QYVNVSSQYYNLTNITYNSQDISVDHHHYEVFTESQLQESQYQRLINIINYGDSIYGSEL
SSHGAVVGEWSGALTDCATWVNGIGIGSRYDGTYYDNMTMYSSNDDSVIGACTSQDDISS
WSQEYKEHVRQFIEAQLATYSSRTSGWIFWNWKTESAGEWDFLKLRDAGLFPTPFDNYTY
FGSDGSMNSQVSQSLSLLAYPTSSGVSSGDDNPKTKNVGVRRSTPVFAMGNKKSDVSISR
TLSHGMLIFLGTLLALCIFI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctacaccttgttgttcatcaccatcacatatatcacacaaacgatccat
gcactaagtgcctccgagctttcgcatttgaagttaaagatccgtaatgtgtccgcacca
acgacgtcatcattaattgaagatcacatcaagggtatcactattggtggttggttagtg
acggaaccatacatcacgccgtcactgtataacaatgccacgagcatgaaccgggggaac
atctccattgtggatgaatacacgctttgtttcgcgttagggtataataaatcactttcg
atactaagtgagcatttcgaaacgtggattactgaagatgatttccaagagattagtgaa
tcggggttcaatttggttaggttacccattgggtattgggcatggaaagtggatcatgct
agtggtttgtatgtggagaacattacgtactctgatccatatgtgagtgaaggtttacaa
ttaggttatttgaagaaggcgattggatgggctgagaagtatggattaaaagtttggatt
gatttgcatggacttcctggatctcagaatgggtttgataattccggtgagagaatcctg
aggagtaatcttggttggttaaatgaggcgcatacgaaaaaattgacattggccatctgg
tcgaagatgttcaaagagtttattggatacagtgattctattgttggtatggaaattgtc
aatgagccgttgagtactaagatcggcattgatgatatcacagaggcatattatgaagcg
tttgatttgttcaagtttcgtcaaaggaaatccaatgacagtgttgtggcagacaatatg
acgtttgtcattcacgatgcgtttgaaccgattggatattggaatttacaattcaatccg
caatatgtgaatgtgtcgagtcaatattacaatctgacgaacattacatataattcgcaa
gatatttcagtggatcatcatcattatgaagtgttcactgaatcacaattacaagagagt
caataccaacgattaatcaatattatcaattatggagattccatttacggaagtgagttg
tcctcacatggtgccgttgtgggtgaatggtccggtgcgcttaccgattgtgccacttgg
gtcaatggtataggtattggatctcgatatgacggtacatattacgataacatgactatg
tacagttccaacgatgattcggtcattggggcgtgcacctcgcaggatgatatcagttcg
tggagtcaggagtacaaggaacatgtgagacaattcattgaagcgcaattagctacgtat
tcgtcgaggacgagtgggtggatcttttggaattggaagacggagagtgctggggaatgg
gatttcttgaaattacgtgatgctgggctattcccgacaccatttgataattacacatat
ttcggcagtgatgggtctatgaattcgcaagtttcgcagtcgttatcgttgttagcgtac
cctacctccagtggtgtttccagtggtgacgataacccgaagactaagaatgtgggtgtg
agaagatcgacaccagtgtttgcgatggggaacaagaagagtgacgtttccattagcagg
acactgagtcatgggatgcttatatttctgggcaccctgttagcgctttgtattttcata
tag

DBGET integrated database retrieval system