KEGG   Naumovozyma castellii: NCAS_0A10740Help
Entry
NCAS_0A10740      CDS       T02233                                 

Gene name
NCAS0A10740
Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00051  Fructose and mannose metabolism
ncs00562  Inositol phosphate metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
ncs01230  Biosynthesis of amino acids
Module
ncs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncs_M00002  Glycolysis, core module involving three-carbon compounds
ncs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0A10740 (NCAS0A10740)
   00051 Fructose and mannose metabolism
    NCAS_0A10740 (NCAS0A10740)
   00562 Inositol phosphate metabolism
    NCAS_0A10740 (NCAS0A10740)
Enzymes [BR:ncs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NCAS_0A10740 (NCAS0A10740)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NCAS_0A10740 (NCAS0A10740)
  Exosomal proteins of bladder cancer cells
   NCAS_0A10740 (NCAS0A10740)
  Exosomal proteins of melanoma cells
   NCAS_0A10740 (NCAS0A10740)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 11529706
NCBI-ProteinID: XP_003674013
UniProt: G0V834
Position
1:complement(2137004..2137750)
Genome map
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGNKKSIKEIVERLNNASLPENVEVVICPPAAYLDYAVSLVNKKQVT
VGAQNTYLKASGAYTGENSVDQVKDTGAKWVILGHSERRSYFHEDDKTVADKTKFALDNG
VGVILCIGETLEEKKAGITLEVVERQLTAVLAEVKDWTNVVIAYEPVWAIGSGLAATPED
AQEIHASIRKFLASKLGQATADQIRILYGGSANGSNAVTFKDKADVDGFLVGGASLKPEF
VDIINSRN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaactttcttcgtcggtggtaacttcaaattgaatggtaacaagaaatccatt
aaggaaattgttgaaagattgaacaacgcttctcttccagaaaacgtcgaagttgtcatc
tgtccaccagctgcttacttagactacgctgtctctttagttaacaagaagcaagtcacc
gtcggtgcccaaaacacttacttgaaggcttctggtgcttacactggtgaaaactctgtt
gaccaagtcaaggacactggtgctaagtgggtcattctaggtcactctgaaagaagatct
tacttccacgaagatgacaagactgtcgctgacaagaccaagttcgctttggacaacggt
gtcggtgtcatcttgtgtattggtgaaaccttagaagaaaagaaggccggtattacctta
gaagttgttgaaagacaattgaccgccgtcttggctgaagtcaaggactggactaacgtc
gttattgcttacgaaccagtctgggctattggttccggtttggccgctaccccagaagat
gctcaagaaattcacgcttctatcagaaagttcttggcttccaagttgggtcaagctact
gctgatcaaatcagaatcttgtacggtggttccgctaacggttctaacgctgttaccttc
aaggacaaggctgatgttgatggtttcttggttggtggtgcttctttgaagccagaattt
gttgacattatcaactctagaaactaa

DBGET integrated database retrieval system