KEGG   Naumovozyma castellii: NCAS_0A13000Help
Entry
NCAS_0A13000      CDS       T02233                                 

Gene name
NCAS0A13000
Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ncs  Naumovozyma castellii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 11529653
NCBI-ProteinID: XP_003674238
UniProt: G0V8Q9
Position
1:2559364..2559693
Genome map
AA seq 109 aa AA seqDB search
MGEYKPGNEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGIFGRNSGQAPGYSYTDANIK
KNVKWDEQKMSDYLTNPKKYIPGTKMAFGGLKKEKDRNDLIAYMKKACE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaatataaaccaggtaacgaaaagaaaggtgctaccttattcaagactagatgt
ctacaatgtcacactgttgaagaaggtggtccacataaagttggtccaaatttgcacggc
atctttggtcgtaattctgggcaagctccaggttattcttacactgatgctaatattaag
aagaatgttaaatgggatgagcaaaagatgtctgattatttgaccaatccaaagaaatat
ataccaggtaccaagatggcattcggtgggttgaagaaggagaaggatagaaatgatttg
attgcttacatgaagaaagcctgtgagtaa

DBGET integrated database retrieval system