KEGG   Naumovozyma castellii: NCAS_0A14630Help
Entry
NCAS_0A14630      CDS       T02233                                 

Gene name
NCAS0A14630
Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0A14630 (NCAS0A14630)
Enzymes [BR:ncs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     NCAS_0A14630 (NCAS0A14630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 11529614
NCBI-ProteinID: XP_003674400
UniProt: G0V971
Position
1:complement(2878338..2880029)
Genome map
AA seq 563 aa AA seqDB search
MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG
YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG
DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL
LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF
PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS
YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP
ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG
CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI
HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML
EVMDAPSNLVAQAQLTASINAKN
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattactttaggtcgctacttattcgaaagattaaagcaagtcaatgttaac
accatttttggtttaccaggtgatttcaacttggctttgttagataagatctacgaagtt
ccaggtatgagatgggctggtaatgccaacgaattgaacgcttcttatgctgctgacggt
tatgctcgtgttaagggtatggcttgtttgattactacttttggtgtcggtgaattgtcc
gccttgaacggtattgctggttcttatgctgaacatgtcggtgtcttacacgtcgtcggt
gtcccatctacctcttcccaagctaagcaactattgttgcatcatactttaggtaatggt
gacttcactgtcttccacagaatgtcttctaacatttctgaaactaccgctatggttact
gatttggctaatgccacatctgaaattgatagatgtattagaactacatatgttactcaa
agaaccgtctatttgggtctaccagctaacatgttcgacttgaaagtcaaggcttctcta
ttggataccccaattgacttatctttgaaacctaatgatgctgctgctgaaaatgaagtc
gttgaaaccattttgtctttggttaaggacgctaagaacccaattatcttggccgatgct
tgttgttccagacacgatgtcaaggctgaaactaagaagttgattgatattactcaattc
ccatcctttgttacaccaatgggtaaaggctccattgatgaacaaaacccaagatatggt
ggtgtctacgtgggtactttgtccaacccagatgtcaaacaagccgttgaatctgctgat
ttgatcttatctgtcggtgcattgttatccgatttcaacactggttctttctcttactct
tacaagacaaagaacgttgtcgaatttcactctgatcacatcaagattaagtctgctact
ttcccaggtgttcaaatgaagtttgtcctacaaaaattattgaaggttatcccatccgtt
gctaagggttacaagccagtcgccgtcccaggtagaccagctccaaacaaaccttcacca
gctaatactccaatgaagcaagaatggatgtggaacgaattggctaaattcttccaagaa
ggtgatgttatcattactgaaacaggtacttctgcctttggtatcaatcaaactccattc
ccaaagaatgcatacggtatttctcaagtcttatggggttccatcggttttgctaccggt
tgtactcttggtgctgcttttgctgctgaagaaattgatccaaagaagagagttatctta
ttcactggtgaaggttctttgcaattgactgtccaagaaatttccacaatggttagatgg
aacttgaagccttacttgtttgtcttgaacaatgctgggtacactattgaaagattgatt
catggtgagaaggccggttacaatgatattcaaccatggaaccatttgaatttgttggaa
actttcggtgctaaggattatgaaaatcacagagtttccactactggtgaatgggaaaaa
ttgactactaacaaggattttaaccaaaactctagaattagattgattgaaattatgttg
gaagttatggatgctccatcaaacttggtcgctcaagctcaattaactgcttccattaat
gctaagaactaa

DBGET integrated database retrieval system