KEGG   Naumovozyma castellii: NCAS_0D00640Help
Entry
NCAS_0D00640      CDS       T02233                                 

Gene name
NCAS0D00640
Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00500  Starch and sucrose metabolism
ncs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0D00640 (NCAS0D00640)
Enzymes [BR:ncs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NCAS_0D00640 (NCAS0D00640)
Glycosyltransferases [BR:ncs01003]
 Polysaccharide
  Storage polysaccharide
   NCAS_0D00640 (NCAS0D00640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4 BAF1_ABF1
Motif
Other DBs
NCBI-GeneID: 11529896
NCBI-ProteinID: XP_003676009
UniProt: G0VEV0
Position
4:complement(109149..111272)
Genome map
AA seq 707 aa AA seqDB search
MTRDLKNHLLFEVATEVANRVGGIYSVLKSKAPITVAQYKENYMLIGPLNKATYQDEIEQ
LDWTAEDSFPGELKPIQDTLHSLKSKGFNFVFGRWLIEGNPKVLLIDLDSIRYRLNEWKS
DLWSLVGIPSPEYDTETNDAILLGYAVVWFLGELTQLDNQHAIIAHFHEWLAGVALPLCR
KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLAYFDVDAEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKINEFVRGH
FHGSFDFDLDNTLYFFIAGRYEYKNKGADMFIESLARLNYRLKVSGSKKTVVAFIIMPAK
TNSFTVEALRSQAVVKSLETTVDEMTKNIGKRIFEHAMRFPHMGVTSEIPTDLTELLKPS
DNVLLKRRVLSLRRPEGELPPVVTHNMVDDANDPILNQIRHVQLFNNASDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKAPDESVEQLVDCMEEFVKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPDQFKQMVGEELNDTNMETLAGGKKLKIARPLSVPGSPRENR
AGSTVFMTPGDLGTLQDANNVNDYFNLSMDGRSIEEDDDDNDDDAAE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgacttgaagaaccacttgctgttcgaagtcgctaccgaagtcgccaacaga
gttggtggtatctactccgtcttgaaatcaaaggctcccattactgtggcccaatacaag
gaaaactacatgctgatcggtccgctaaacaaggctacttatcaggatgaaatcgaacaa
ctagattggaccgctgaggattccttccccggtgaattgaaaccaatccaagataccttg
cattctttgaaatccaagggtttcaattttgtctttggccgttggttaatcgagggcaac
cccaaagttttattgatcgatttggattccattagatatcgtcttaacgaatggaaaagt
gacctttggtcccttgtcggtatcccatccccagaatacgacacagagacaaatgatgct
atcttgctaggttacgctgtcgtttggttcttgggtgaattgactcaattggataaccaa
catgccatcattgctcatttccatgaatggttagctggtgtcgcgctaccattgtgcaga
aagaagagaatcgatgtcgttaccatctttaccactcatgctactttattaggtagatat
ctttgtgctgctggtgacgtggatttctacaataacttggcttatttcgatgtggatgct
gaagctgggaagagaggtatttaccacagatattgtatcgaacgtgctgcagctcatact
gcggatgttttcactaccgtctcacaaattaccgctttagaggccgaacatttgttaaag
aggaaaccagatgggattttgcccaatgggttgaatgtggtcaagtttcaagcggttcat
gaattccaaaatttgcatgccttgaagaaggaaaagattaatgaattcgttagaggtcat
ttccatggttcattcgatttcgatttggataataccttatatttctttatcgctggtaga
tatgaatataagaataagggtgctgatatgtttattgaatccctagctcgtttgaattat
agattaaaagtctctggatccaagaagacagtggttgcattcattattatgcctgcaaag
actaattcatttaccgtggaagctctaagaagtcaagcagtggtcaaatcattggaaact
acagtggatgaaatgacaaagaacattggtaagagaatctttgaacatgcaatgagattc
ccacacatgggtgtcacttctgaaatacctaccgatttaactgaattattgaaaccatca
gacaatgtccttttaaagagacgtgtattgtctctaagaagaccagaaggtgaattacca
ccagtggtgacccataacatggtcgatgatgctaatgatccaatcttaaaccaaattaga
cacgtgcaattattcaataatgcaagtgatagagtcaaagttattttccatcctgagttt
ttgaatgcaaacaatccaatcctgggtttagattacgatgaatttgtcagaggttgtcat
ttaggtgtcttcccctcatactatgaaccttggggttacactccagctgaatgtaccgtt
atgggtgtcccatccattactacaaatctttccgggtttggtgcatacatggaagatttg
attgaaactaaccaagctaaggattacggtatttacattgtggatcgtcgtttcaaggct
cctgatgaatcagtggaacaattagtggattgcatggaagaattcgttaagaagactaga
agacaaagaattaaccaaagaaatagaactgaaagattgtctgatttattagattggaaa
cgtatgggattggaatacgtcaaggctagacaattggccctacgtagagcatacccagac
caattcaagcaaatggtcggtgaagaattaaatgacaccaatatggaaacattggctggt
ggtaagaaattaaagattgctagaccattaagtgttccaggttctccaagagaaaacaga
gcgggaagcaccgtgttcatgactccaggtgatttaggtactcttcaagacgctaataat
gtcaacgattacttcaacttgagtatggatggaagatccatagaggaagatgatgatgat
aatgatgacgatgctgctgaatga

DBGET integrated database retrieval system