KEGG   Naumovozyma castellii: NCAS_0E00630Help
Entry
NCAS_0E00630      CDS       T02233                                 

Gene name
NCAS0E00630
Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00071  Fatty acid degradation
ncs00410  beta-Alanine metabolism
ncs00592  alpha-Linolenic acid metabolism
ncs00640  Propanoate metabolism
ncs01040  Biosynthesis of unsaturated fatty acids
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01200  Carbon metabolism
ncs01212  Fatty acid metabolism
ncs04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCAS_0E00630 (NCAS0E00630)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCAS_0E00630 (NCAS0E00630)
   00592 alpha-Linolenic acid metabolism
    NCAS_0E00630 (NCAS0E00630)
   01040 Biosynthesis of unsaturated fatty acids
    NCAS_0E00630 (NCAS0E00630)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCAS_0E00630 (NCAS0E00630)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCAS_0E00630 (NCAS0E00630)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     NCAS_0E00630 (NCAS0E00630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 11530303
NCBI-ProteinID: XP_003676494
UniProt: G0VF68
Position
5:109048..111297
Genome map
AA seq 749 aa AA seqDB search
MTRTTTQKRGSPVLNPQKFITQERLNSKLDIDQINTFLESNPTRQALTHSLVEQIIYDPV
LKTDTDYYDQTKEQLRLNTAKKINRLSIYMEHDIKTAREQFRDQDLMKQLQTESSTVPPL
TNKDISIFDKRLSLVANMDPQLGTRVGVHLGLFGNCIKGNGTDEQIKYWLQERGATLIKG
IYGCFAMTELGHGSNVAQLQTRAVYDVKKDCFIIDTPDLTATKWWIGGAAHSATHTVVYA
RLIVNEKDYGVKTFVVPLRDTSTFQLLPGIAIGDIGSKMGRDGIDNGWIQFRNVVIPREF
MLSRFTKVIPRPNGANPIVKTEPQLDAISGYSALLSGRVNMVMDSFRFGSKFATIGIRYA
VGRQQFAPKKNAEETQLIDYPLHQYRVLPQLVIPYLVSPAAFKLMDNYYSTLDELYAVSS
SGDKVKLAKVSSKLKNLFIDSASLKATNTWLIAQLIDELRQSCGGHGYSQYNAFGKGYDD
WVVQCTWEGDNNILCLTSAKSILKKFVDSATMGKYDKELDSDSFGYLDPKYIMGIFSGSS
KIELDKLSGYRDVWAISLVKLLGHIAKIVEKSRNIDGVSKLLVLVAKFHAIHYMLKTYYV
KLSNPGESYVTDEATRDALWNAYKLFSIYFIDKHSGEFQQLEIFKPREISQLIQPKLMEL
LPLIRNDAIALTDAFKLPDAMINAPIGYYDGDIYHNYFNEVCKNNPTEKDGAGIPSYHGL
LSSMLGRGFEFDARLGGAAAAETLAQLNK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgactagaacaacaacacaaaagaggggttcgcccgtgttgaacccacaaaagtttatc
actcaagaaagattgaattctaagttggatatcgatcaaataaacacattcttggaatca
aaccccacaagacaagcgctaacgcattcgctcgttgaacaaatcatttacgaccctgtc
ctcaagactgacacagactattatgaccaaacaaaggaacaacttagattgaacactgct
aagaaaattaatagattgtccatttacatggaacatgatattaagactgccagggaacag
ttccgtgatcaagatttgatgaaacaattacagactgaatcatccactgtcccacctttg
actaacaaggatatttctatctttgataaaagactgtccttagtggctaacatggatcca
caattgggtactcgtgtcggagttcacttgggtttgtttggtaattgtattaagggtaat
ggtaccgatgaacaaattaaatattggttacaggaaagaggtgctactttaattaaggga
atttatggttgttttgccatgactgaattgggtcatggttccaatgtggcacaattacaa
acaagagctgtgtatgatgtaaagaaggattgttttattattgatactcctgatttaact
gcaaccaaatggtggatcggtggtgcagctcattcagccactcatactgtagtttatgca
agattgattgttaacgagaaggattatggtgttaagacatttgtggtaccactaagagac
acttccactttccaactactccctggtattgccattggtgacattggtagtaagatgggt
agagatggtattgataacggttggattcaatttagaaatgtggtgattccacgtgaattt
atgttaagtagattcacaaaagtcatcccaagaccaaatggtgcaaacccaattgtgaaa
actgaacctcaattagacgcaatttcaggttatagtgcattattaagtggtagagttaat
atggtaatggattcattcagattcggttctaaatttgccacaattggtattagatatgct
gtaggaagacagcaatttgctccaaagaaaaatgcagaggagactcaattaattgattat
cccttacatcaatatcgtgtcctaccacaattagttatcccatatttggtatctccagca
gcattcaaattaatggataattattattcaactttagatgaactttacgcagtttcttct
tccggtgataaggttaaattggcaaaagtcagttctaaattaaagaatttattcattgac
agtgcaagtttgaaggccacaaatacatggttaattgcccaattgattgatgaattaaga
caatcatgtggtggtcacgggtattctcaatataatgcattcggtaaaggctatgatgac
tgggtggttcaatgtacttgggaaggtgataataatatcttgtgtttaacatctgctaaa
tccatattaaagaagtttgtcgactctgctaccatgggtaaatatgacaaagaattggat
tctgattcgtttggttatttggatcctaagtatattatgggtatcttttctggttctagt
aagattgaattggataaattaagtggctacagagatgtttgggccattagtttagttaaa
ttattgggtcatattgccaaaattgtagaaaaatcaagaaacattgatggtgtttcaaaa
cttttagttttggtagcaaaattccacgccatccattatatgttgaagacatattatgtt
aaattatctaaccctggtgaatcttatgtgaccgatgaggctacaagagatgctttatgg
aatgcctataaattgttttcaatttattttattgataagcattcaggtgaattccaacaa
ttggaaatatttaaaccaagagaaatttctcaattgattcaaccaaaattgatggaattg
ttacccttaataagaaatgatgctattgccctaaccgacgcctttaaattgcctgatgca
atgataaacgcaccaattggttattatgacggtgatatttatcacaattatttcaatgaa
gtttgtaaaaataatccaactgaaaaggatggtgccggtattccatcctatcatgggttg
ttatcaagtatgttgggtagaggatttgaatttgatgctaggttgggtggcgctgctgct
gcagaaactttggctcaattaaataagtaa

DBGET integrated database retrieval system